KEGG   Thermocrinis albus: Thal_1553Help
Entry
Thal_1553         CDS       T01179                                 

Definition
disulfide bond isomerase, DsbC/G-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tal  Thermocrinis albus
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1448671..1449411
Genome map
AA seq 246 aa AA seqDB search
MKKAIFLTGLLVLSAGMWACSGSAACPTKDKVKTSVKDLIPGDFTVEEVNPLKDIKGLCE
VVVKVGASPIVFYMDQKGEYVLAGNLLSLKDKKNLTRERQQEFMKISQDKVKELEKYTDM
TFGAKGSGKFIYFFTDPDCPFCKRSEPIVEEWAKKNNVEVRVILYPLPIHPDAFPKSVSL
VCDKKTWEDYKRGYMGSQCEEGKKKVQSNLELGQKLGINGTPTFIGMNGKVQSGLPTEDD
LNKLIN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggctatctttctgacaggtcttttggttctttctgccggtatgtgggcctgc
agcggttctgcggcgtgtcccaccaaagacaaggtaaagacatcggtgaaagatcttatt
ccgggtgatttcaccgtggaggaggtgaaccccctgaaggatataaagggactgtgtgag
gtggtagtaaaagtaggtgcgtcccccatagttttttacatggatcagaaaggagaatat
gtccttgcgggcaacttactttctctaaaggataagaaaaacctcacaagggagcgccaa
caggagtttatgaagataagccaggataaagtgaaggagctggaaaagtacaccgacatg
acctttggagcaaaaggtagcggtaagttcatctatttcttcacggatcccgactgtccc
ttctgtaaaaggtcggaacctatagtggaagagtgggccaaaaagaataatgtggaagtg
cgcgttatactgtatcctctacccatacacccagacgcctttcccaaatctgtttcttta
gtgtgtgataaaaaaacatgggaagactataagaggggttatatgggcagtcagtgtgag
gaaggtaaaaagaaagtgcagagcaatctggagctgggacaaaagctaggcataaacggt
acccctacctttataggtatgaacggaaaagttcagtcaggccttcccacagaggatgac
ttgaacaaactgataaattga

DBGET integrated database retrieval system