KEGG   Thermocrinis albus: Thal_1560Help
Entry
Thal_1560         CDS       T01179                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tal  Thermocrinis albus
Pathway
tal00330  Arginine and proline metabolism
tal00332  Carbapenem biosynthesis
tal01100  Metabolic pathways
tal01130  Biosynthesis of antibiotics
tal01230  Biosynthesis of amino acids
Module
tal_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tal00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Thal_1560
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Thal_1560
Enzymes [BR:tal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Thal_1560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ADC90189
UniProt: D3SN59
Position
1454100..1455161
Genome map
AA seq 353 aa AA seqDB search
MRIVLKIGSNLIQTEDGDIDLTFLSKLAKEIKSLVQAEHELVIVSSGAVLCGLKKLGLTE
RPKELLEKQVLAGIGQAYLMHLYDMVFSNYGLVPAQVLLTSDVFRDKGKFYTVKGVVEKM
LKMKVIPIINENDTVAVAELIFGDNDFLAVHTAFMLDADLLVFFSSAGGLRNHDDRVIPV
IEDIDAAFQYVRSVRSSYGTGGMISKLTATRIALRLGIPVVITGKEDSLLDVKDKNTKGT
YFKPYPKGLKPGKRWLAMIEEPKGALYIDEGAYAAIKKGKSLLPAGIQRVEGYFSRGDVV
GVYTSDGVLVGKGRVNFSSEELKLILGKKGDEVKRVLKTTKEEAIHRDSLVVF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatagttctgaaaataggctctaacctgatacagaccgaggacggggatatagac
cttacttttctttccaagctagctaaggaaataaaaagtctcgtgcaggctgagcatgag
ctggtgatagtatcgtcgggtgcggtactgtgtgggctcaaaaagctgggtttgacggaa
agacctaaagagcttctcgagaaacaggttctggcaggcataggtcaagcttatcttatg
catctctatgacatggttttttccaactacggtttggtaccggctcaggttcttctcacc
tcagatgtcttcagggataagggaaagttttataccgtcaaaggtgttgtggagaaaatg
ctaaagatgaaggtcattcctatcatcaatgagaacgacacagtggcggtggcggagctt
atttttggagacaacgactttttagcagtgcacacagcctttatgctggatgcggatctt
ttagttttcttttccagtgcaggtggtttgcgaaatcatgatgacagggtaatacctgtt
atagaggatatagatgcagcattccagtatgttagaagtgtaaggtcctcttatggaaca
gggggtatgatcagcaagctcaccgccacccgtatagccctccgactgggtatacctgtt
gttataactggaaaggaagactctctacttgatgtgaaggacaaaaacacaaagggtacc
tactttaaaccttatccaaagggtttgaaaccaggtaaaagatggctcgccatgatagag
gaaccaaaaggtgccctttacatagacgaaggggcctacgctgccataaagaaaggtaag
agtctcttgcctgcaggtatacagagggtagagggttacttctcaaggggtgatgtggtg
ggtgtttacacctctgacggtgtactggtaggcaaggggagagtgaacttttcttctgag
gagttgaaactcatcttgggcaagaagggggatgaggtgaaaagagtgctgaagactaca
aaagaggaggccatccacagggacagcctggtagttttttag

DBGET integrated database retrieval system