KEGG   Thermovibrio ammonificans: Theam_0181Help
Entry
Theam_0181        CDS       T01391                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00260  Glycine, serine and threonine metabolism
tam00750  Vitamin B6 metabolism
tam01100  Metabolic pathways
tam01110  Biosynthesis of secondary metabolites
tam01120  Microbial metabolism in diverse environments
tam01230  Biosynthesis of amino acids
Module
tam_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theam_0181
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Theam_0181
Enzymes [BR:tam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Theam_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP PK_C Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: ADU96154
JGI: Theam_0181
UniProt: E8T3M3
Position
complement(166574..167635)
Genome map
AA seq 353 aa AA seqDB search
MRAWRGIIEEFREFLPVSEKTPVITLLEGNTPLIKADNLAREILPGLNLYLKFEGLNPTG
SFKDRGMTMAVSKAVEEGAKAVICASTGNTSASAAAYAAKAGLKAVVLIPEGKIALGKLS
QAVMYGAEVVQIKGNFDDALEIVREIGAEYPITIVNSINPYRLQGQKTAAFEICEQLGRA
PDYHFIPVGNAGNITAYWMGYKEYFEAGKVDSKPKMCGWQAAGAAPIVLGHPVKNPETIA
TAIRIGNPASWKGAVNAAKESGGFIDMVTDEEILEAYRLVARTEGIFCEPASAASIAGVI
KSVRTKGLLKAGDVVVCTLTGHGLKDPDTAISMGVKPITLPADKEEIVKALGF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctggagaggtattatagaagagttcagggagttcctacccgtttccgagaag
acccccgtcatcaccctgctggagggaaacacccccctcataaaggccgacaacctcgca
agggagattctaccaggactcaacctatacctgaagtttgaagggcttaaccccacaggc
tccttcaaggacagaggcatgactatggccgtctccaaggcggttgaggagggggcaaag
gcggttatctgcgcctccaccggtaacacctccgcatcggcggcggcctacgcggcaaag
gccgggcttaaagccgttgtcctcattcccgaggggaagatagccctggggaagctctcc
caggcagttatgtacggagccgaggtcgtccagataaaggggaacttcgacgacgccctc
gagatagtaagggagataggggccgagtacccgataaccatagtaaactccataaacccc
tacagacttcagggtcagaaaaccgccgccttcgagatatgtgagcagctgggcagggcc
cccgactaccacttcatacctgtgggcaacgccggcaacattacagcctactggatgggc
tacaaagagtacttcgaggctggcaaggtggactcaaagccgaagatgtgcggctggcag
gcggcaggggcggcaccgatagtgctgggccatccggtaaagaacccggagaccatagca
acggccataagaataggaaacccggcaagctggaagggtgccgttaacgccgcgaaggag
tcggggggcttcatagacatggttacagacgaggaaatccttgaggcctacaggctcgtt
gccagaaccgaagggattttctgcgagccggcatcggcggcatcgattgcgggagttata
aagagcgttcgtaccaagggcctccttaaggccggagacgttgtggtctgcacccttacc
ggccacggactcaaagacccggacaccgcaatctccatgggggttaaaccgataaccctg
cctgcagataaagaagaaatcgttaaagctttagggttttaa

DBGET integrated database retrieval system