KEGG   Thermovibrio ammonificans: Theam_0181Help
Entry
Theam_0181        CDS       T01391                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theam_0181
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theam_0181
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Theam_0181
Enzymes [BR:tam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Theam_0181
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(166574..167635)
Genome map
AA seq 353 aa AA seqDB search
MRAWRGIIEEFREFLPVSEKTPVITLLEGNTPLIKADNLAREILPGLNLYLKFEGLNPTG
SFKDRGMTMAVSKAVEEGAKAVICASTGNTSASAAAYAAKAGLKAVVLIPEGKIALGKLS
QAVMYGAEVVQIKGNFDDALEIVREIGAEYPITIVNSINPYRLQGQKTAAFEICEQLGRA
PDYHFIPVGNAGNITAYWMGYKEYFEAGKVDSKPKMCGWQAAGAAPIVLGHPVKNPETIA
TAIRIGNPASWKGAVNAAKESGGFIDMVTDEEILEAYRLVARTEGIFCEPASAASIAGVI
KSVRTKGLLKAGDVVVCTLTGHGLKDPDTAISMGVKPITLPADKEEIVKALGF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgagagcctggagaggtattatagaagagttcagggagttcctacccgtttccgagaag
acccccgtcatcaccctgctggagggaaacacccccctcataaaggccgacaacctcgca
agggagattctaccaggactcaacctatacctgaagtttgaagggcttaaccccacaggc
tccttcaaggacagaggcatgactatggccgtctccaaggcggttgaggagggggcaaag
gcggttatctgcgcctccaccggtaacacctccgcatcggcggcggcctacgcggcaaag
gccgggcttaaagccgttgtcctcattcccgaggggaagatagccctggggaagctctcc
caggcagttatgtacggagccgaggtcgtccagataaaggggaacttcgacgacgccctc
gagatagtaagggagataggggccgagtacccgataaccatagtaaactccataaacccc
tacagacttcagggtcagaaaaccgccgccttcgagatatgtgagcagctgggcagggcc
cccgactaccacttcatacctgtgggcaacgccggcaacattacagcctactggatgggc
tacaaagagtacttcgaggctggcaaggtggactcaaagccgaagatgtgcggctggcag
gcggcaggggcggcaccgatagtgctgggccatccggtaaagaacccggagaccatagca
acggccataagaataggaaacccggcaagctggaagggtgccgttaacgccgcgaaggag
tcggggggcttcatagacatggttacagacgaggaaatccttgaggcctacaggctcgtt
gccagaaccgaagggattttctgcgagccggcatcggcggcatcgattgcgggagttata
aagagcgttcgtaccaagggcctccttaaggccggagacgttgtggtctgcacccttacc
ggccacggactcaaagacccggacaccgcaatctccatgggggttaaaccgataaccctg
cctgcagataaagaagaaatcgttaaagctttagggttttaa

DBGET integrated database retrieval system