KEGG   Thermovibrio ammonificans: Theam_0234Help
Entry
Theam_0234        CDS       T01391                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tam  Thermovibrio ammonificans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Theam_0234
   00052 Galactose metabolism
    Theam_0234
   00500 Starch and sucrose metabolism
    Theam_0234
   00520 Amino sugar and nucleotide sugar metabolism
    Theam_0234
Enzymes [BR:tam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Theam_0234
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(220545..221444)
Genome map
AA seq 299 aa AA seqDB search
MVRKAVIPVAGLGTRFLPATKAQPKEMLPLVDKPVIQYIVEEAVAAGITQIIFVTGRHKR
AIEDHFDRNLELERALEEKQKEELLKTVREISKLADFIYIRQKEPKGLGHAILTAEPAVG
NEPFAVLLGDDIMVSEPPGIRQLIEVFHRYKCSVVGLERVPQEEVDRYGIVKATEIERGI
FKVEDMVEKPAVEEAPSNLAIAGRYVLTPSIFETLRRTPPGKGGEIQLTDALKLLSNKEA
IYGRILEGKRYDTGNKLGFLEATVDFALMRDDLREPFLRFLKRKVEEELNDGRADTAPQ
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggtcaggaaagcagtaattccggttgcgggcctcggcaccaggttcctgcccgcaacg
aaggcacaaccgaaagagatgctgccgctcgttgacaagccggtaatccagtacatcgta
gaagaggcggtagcggcgggcataacccagataatcttcgtaacgggccgccacaaacgg
gcgatagaggaccacttcgacaggaacttagagctcgaaagggccctcgaggaaaagcag
aaggaggagctccttaaaaccgttagggagatatcgaagctggccgactttatctacatt
aggcagaaagagcccaaaggactgggccacgcaatacttacggccgagccagccgtggga
aacgagccctttgccgtgctgctgggagacgacataatggtctctgaaccgcccggtata
aggcagcttattgaagttttccacaggtataagtgctcggttgtcggccttgagagggta
cctcaggaagaggttgacaggtacggaatcgtgaaagccacggagatagaaaggggcatt
tttaaagtagaggatatggttgaaaagccggctgtagaggaggccccttcaaaccttgca
atagccggacggtacgttctcacaccgtctatatttgaaaccttaaggagaactcccccc
ggtaagggtggagagattcagctcacagacgccctcaagctgttgagcaacaaagaggcc
atctatggtaggatattagagggtaaacgttacgacaccggcaacaagctcggattcctt
gaagccaccgtagactttgccctcatgagagacgacctgagagagccgttcctccgtttc
ctaaaaagaaaggtagaagaggagttaaacgatggccgagctgatacagcaccacaataa

DBGET integrated database retrieval system