KEGG   Thermovibrio ammonificans: Theam_0376Help
Entry
Theam_0376        CDS       T01391                                 

Definition
Aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_0376
   01230 Biosynthesis of amino acids
    Theam_0376
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theam_0376
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Theam_0376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(345328..347337)
Genome map
AA seq 669 aa AA seqDB search
MEFTTLTVDLLEGKATLRREKGKGVFGVLDYGLKVHEELKTYKHAPYSPYNAVVFGKGPF
AGSILPGSHRLVFFFRSPLYKTLYPSTMGGAAYTFQRTGVDFVTLIGKAQKPSVLVIEGL
ERSVKVYVEPLEEELQTLWKGTTERFGVYSFTDYLVEKFKNRIAGEFRVACVGPASLTTD
YGAIFSQTLRNGTPVEGSEDWAARGGGGSVLLRAHNIAAVIFGGIYREEKRVISNPDQTK
KVFGAVYSKPLFQVITEKTTKYRYNPKHKTGGTFGEDYYAEREKTPVLNWQMPYIPREER
VKLFKVIEKEYLEIFNKEAIETKSWTTCGEPCPAACKKVRNGLKTDYEPYNANGPLAGNV
YLKAADSAVRTVDALGFDAIEFGGAAAWIFELVARGILKPEEAGISGKPVLDLNEIQKSP
KEVSKKNAELLVELAHKVAYPEAELHKLLGKGKRKAAAFIDSRYGERLPKGKSSLDYAVL
VALGTEGEVNPTMYWAVGNFVPLPVQGKYWTYYKFGVFPEPEALAEKIAESSISEFWYDN
VGWCRFHRRWLTAGPSSCELEGECELERSLSKPVLERLFEVVYGERIDLAEHAKNVLSRL
CDYALKADCYPVFPPSERVVDLIAAASSEFGNKRWEERFKESKVKAVREYLSSTLTAYGE
LIGYDRWRL
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggagtttaccaccctaaccgtagacctcctcgaggggaaggcaacccttagaagggaa
aaggggaaaggcgttttcggcgttctcgactacggcttaaaagtccacgaggagctgaaa
acctacaagcacgccccctactccccttataacgcagttgttttcggcaagggccccttt
gccggctcgatacttcccggctctcaccggctcgtcttcttcttcaggtctcccctctac
aaaaccctctacccctcaaccatgggaggggcagcctacaccttccagaggaccggcgtt
gactttgtgacactcataggaaaggcccaaaagccgtcggttctggttatagaggggctc
gaaaggagcgtaaaggtttacgtagaacctttagaagaggagcttcaaaccctctggaag
ggaacgaccgagcgcttcggcgtttacagcttcaccgactacttagtggagaagttcaaa
aacaggatagcgggcgaattcagggttgcctgcgtggggcccgcatccctcacaaccgac
tacggggcaatcttttcgcagaccctcagaaacggcactcccgtagaggggagcgaagac
tgggccgcaaggggcggaggaggcagcgttctcctgagagcccacaacatagcggccgta
attttcggaggaatctacagggaagagaagagggttatctccaaccccgaccagacgaaa
aaagtcttcggggccgtttactccaagcccctcttccaggtgataaccgagaaaacgacc
aagtaccgctacaacccgaaacacaaaaccgggggaaccttcggagaagactactacgcc
gaaagggaaaagaccccggttttaaactggcagatgccctacataccccgggaagagagg
gtgaagctcttcaaggtgatagagaaggagtaccttgaaatcttcaacaaggaggcgata
gagacaaagagctggacaacctgcggcgagccgtgccccgccgcctgcaaaaaggtcagg
aacggactgaaaaccgactacgaaccttacaacgccaacggcccccttgcagggaacgtt
tacctgaaggcggcagacagcgcagtcagaacggtagacgccttagggttcgacgccata
gagttcggcggcgcggccgcctggatatttgagctcgtggcaagggggattttaaagccg
gaagaggcgggtataagcggtaagcccgttctcgacctgaacgagattcaaaaaagcccc
aaggaggtatcgaagaagaacgcagagcttctggtagagcttgcccacaaagtggcatac
cccgaagcggagctccacaaactcctgggaaagggcaaacggaaggcggcagccttcata
gatagccgctacggcgagaggctgcccaaggggaagagctccctggactacgccgtttta
gttgcactcggaacggaaggtgaggtaaaccccacaatgtactgggccgtggggaacttc
gttccgctgccggttcagggaaagtactggacctactacaagttcggggtattcccggag
cccgaggccctggccgagaaaattgcggagagctcaatatctgagttctggtacgacaac
gtgggctggtgcaggttccacaggcgttggcttacggcagggccgagcagctgcgagctg
gagggtgagtgtgagcttgagcgaagcctctcaaagcccgttctcgaaaggctgtttgag
gttgtttacggcgagaggatagaccttgcagaacacgccaaaaacgttctatcaaggctt
tgcgactacgccctcaaggcggactgctacccggtgttcccgccctcggagcgggttgta
gacctcatagccgcggcaagcagcgagttcggcaacaagaggtgggaagagcggttcaaa
gagagtaaagtgaaggcggtcagggagtacttaagcagcaccctaaccgcctacggagag
ctcataggttacgacaggtggaggctataa

DBGET integrated database retrieval system