KEGG   Thermovibrio ammonificans: Theam_0395Help
Entry
Theam_0395        CDS       T01391                                 

Definition
hypothetical protein
Organism
tam  Thermovibrio ammonificans
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
360553..361233
Genome map
AA seq 226 aa AA seqDB search
MFRAIAILFPLFLFSTVLASECPSLYRVQAVLASSGYPFIVKGVEPVNGTSLCRVFTVSG
EELLVTSNLRFVVEGKLKPLKPLRLSERELEILRSEILFSVGKGPELLLLTNPLCSACRS
HRALLDELAARFRVEFVPVGFEGREFEAAVSAYCLGLKPSQFFRFNGPFKVCNLGKLKVW
SVQAVLKRHGLFGTPVAVDSAGRVYVGADEIAGLVKGRASLPSQSP
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgggcgatagcaattttattccctctgtttctcttttccacagttttggcctct
gagtgtccgtccctctatagggtacaggcggttttagcttcttccggttacccctttata
gttaagggggttgaaccggttaacggaacttccctgtgtagggtctttacagtttcggga
gaggagctcctggtaacttccaacttgaggttcgttgttgaggggaagctcaagcctcta
aaaccgctaaggctctcggagagggagctggaaatcttgaggtctgagattctcttctct
gttgggaaggggcccgagcttctcctccttacaaaccccttgtgtagcgcgtgtcgcagc
cacagggcactgctggatgagcttgccgcccgtttcagggttgagtttgttccggtaggg
tttgagggaagggagtttgaggctgcggtttccgcctactgtttggggcttaagccttcc
cagttcttccggtttaacggtccgtttaaggtgtgtaacctcgggaagctgaaggtttgg
agcgttcaggcagttttgaagcgccacgggctcttcgggactccggtggccgttgactct
gccggcagggtctacgtaggtgccgacgagatagcagggcttgttaaaggaagagcttct
ttaccttctcaatctccatag

DBGET integrated database retrieval system