KEGG   Thermovibrio ammonificans: Theam_0436Help
Entry
Theam_0436        CDS       T01391                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00260  Glycine, serine and threonine metabolism
tam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tam01100  Metabolic pathways
tam01110  Biosynthesis of secondary metabolites
tam01130  Biosynthesis of antibiotics
tam01230  Biosynthesis of amino acids
Module
tam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theam_0436
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theam_0436
Enzymes [BR:tam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theam_0436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB DUF3085
Motif
Other DBs
NCBI-ProteinID: ADU96408
JGI: Theam_0436
UniProt: E8T570
Position
396418..397212
Genome map
AA seq 264 aa AA seqDB search
MERIAATFSELEARGEKPLIVYATACDPNCSKSLDFFKLILEFADMVEVGMPFSDPLADG
PTIQKAHERALASGANTVRVLELVEKLRAFAPTKPIILMGYYNPIFAYGEDRFIKDAKAA
GADGFIVPDLPPEEGRDFSRKAKSLKLSPVFLAAPTSTDERVKLIGEVTGDFIYYVSVTG
ITGEREKLAYKQIEEDIARVKRISGKRTVVGFGISRPEHIKEMYNSPDGFVVGSAVVRRI
EQEDFEGLRELLSSLKEATKRSSL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggaaagaatagccgccaccttctctgagctcgaggcgaggggagagaaacctcttata
gtttacgcaactgcctgtgacccgaactgttcaaagtccctcgatttcttcaaactcata
cttgagtttgccgacatggttgaagtgggaatgcccttctccgacccccttgccgacggc
cctacgattcagaaagcccacgaaagggcccttgcctccggggcaaacacggtaagggtg
ttggagctggttgagaagctcagggcttttgctcccacaaagcccataatccttatgggt
tactacaaccccatattcgcatacggggaagaccgcttcattaaagacgcaaaggccgcc
ggagcagacggcttcatagtcccggacctgcctcccgaggaggggagggacttctcgagg
aaggcaaagtctttgaagctctctcccgtgttccttgccgccccaaccagcaccgacgag
agggttaagctcataggggaggttacgggagacttcatctactacgtttccgttaccgga
ataacgggcgagagggagaagctggcctacaagcagatagaggaggatatagcaagggtt
aagcgcatctccggtaagaggacggtggtaggcttcggtatatcccggccggagcatata
aaagagatgtataatagtccagatggctttgttgtaggcagcgccgttgttaggcgtata
gagcaggaggactttgaagggttgagagagcttctctcctctctgaaagaagcgacgaaa
cgcagttccctataa

DBGET integrated database retrieval system