KEGG   Thermovibrio ammonificans: Theam_0520Help
Entry
Theam_0520        CDS       T01391                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tam  Thermovibrio ammonificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Theam_0520
Enzymes [BR:tam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Theam_0520
Exosome [BR:tam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Theam_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
473282..474277
Genome map
AA seq 331 aa AA seqDB search
MLTGRFPQLRLRRLRKNENVRRMVRETVLTPNDFIYPIFVVDGENKKEEIPSMPGQFRYS
VDRLPEMVEEVEKAGIPAVILFGIPSHKDELGTDSYSEEGIIQRALRKIKGEGSKLYLIT
DVCFCEYTSHGHCGYLECHGEVCDVDNDRTLELLKKQVVSHAQAGADMVAPSGMMDGMIA
AIREALDAAGFTDIPIMSYAAKYASAYYGPFRDAAESTPAFGDRRSYQMDPANFNEALRE
VALDIQEGADIVMVKPALAYLDVIRAVKETFKYPTAAYNVSGEYSMVKAAALKGWIDEKR
VVLETLTSMKRAGADLILTYHALEAARWLNE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccgggaggttcccccagctgagactcaggcgtttgaggaaaaacgaaaacgta
aggcgtatggtcagggagaccgttctcacccccaacgactttatatacccgatattcgtt
gtagacggtgagaataagaaagaggagattccctctatgcccggccagttccgctactct
gtggacaggcttcccgaaatggttgaggaggttgagaaggcgggtattccggcggtaatc
ctctttggaattccctcccacaaggacgagctcggaacggactcctactccgaggagggc
ataatccagagggctctgagaaaaataaagggggagggttcgaagctctaccttattacc
gacgtctgcttctgtgagtacacaagccacggccactgcggctaccttgagtgccacgga
gaggtgtgtgacgttgataacgacagaaccctcgagctcctgaagaagcaggtggtttcc
cacgcccaggccggggccgatatggtggccccctcgggaatgatggacggtatgattgcg
gcaatcagggaagccctcgatgctgcaggctttacagacattccgattatgtcttacgcc
gccaagtacgcctctgcatactacggacccttcagggatgccgcagagtccacccccgct
ttcggcgacaggcgctcctaccagatggaccctgcaaacttcaacgaggccctgagagag
gtggccctcgacattcaagagggtgccgacatagttatggtaaagcccgcccttgcctac
cttgacgttatcagggccgttaaggagacctttaagtacccgactgccgcctacaacgtt
agcggcgagtactctatggtgaaggctgcggcccttaagggctggatagacgaaaagcgg
gtagtgctcgaaacccttacctctatgaagagggcgggagccgacctgattctcacctac
cacgcccttgaggcggcgaggtggttaaacgaatag

DBGET integrated database retrieval system