KEGG   Thermovibrio ammonificans: Theam_0520Help
Entry
Theam_0520        CDS       T01391                                 

Definition
Porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tam  Thermovibrio ammonificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tam00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
473282..474277
Genome map
AA seq 331 aa AA seqDB search
MLTGRFPQLRLRRLRKNENVRRMVRETVLTPNDFIYPIFVVDGENKKEEIPSMPGQFRYS
VDRLPEMVEEVEKAGIPAVILFGIPSHKDELGTDSYSEEGIIQRALRKIKGEGSKLYLIT
DVCFCEYTSHGHCGYLECHGEVCDVDNDRTLELLKKQVVSHAQAGADMVAPSGMMDGMIA
AIREALDAAGFTDIPIMSYAAKYASAYYGPFRDAAESTPAFGDRRSYQMDPANFNEALRE
VALDIQEGADIVMVKPALAYLDVIRAVKETFKYPTAAYNVSGEYSMVKAAALKGWIDEKR
VVLETLTSMKRAGADLILTYHALEAARWLNE
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccgggaggttcccccagctgagactcaggcgtttgaggaaaaacgaaaacgta
aggcgtatggtcagggagaccgttctcacccccaacgactttatatacccgatattcgtt
gtagacggtgagaataagaaagaggagattccctctatgcccggccagttccgctactct
gtggacaggcttcccgaaatggttgaggaggttgagaaggcgggtattccggcggtaatc
ctctttggaattccctcccacaaggacgagctcggaacggactcctactccgaggagggc
ataatccagagggctctgagaaaaataaagggggagggttcgaagctctaccttattacc
gacgtctgcttctgtgagtacacaagccacggccactgcggctaccttgagtgccacgga
gaggtgtgtgacgttgataacgacagaaccctcgagctcctgaagaagcaggtggtttcc
cacgcccaggccggggccgatatggtggccccctcgggaatgatggacggtatgattgcg
gcaatcagggaagccctcgatgctgcaggctttacagacattccgattatgtcttacgcc
gccaagtacgcctctgcatactacggacccttcagggatgccgcagagtccacccccgct
ttcggcgacaggcgctcctaccagatggaccctgcaaacttcaacgaggccctgagagag
gtggccctcgacattcaagagggtgccgacatagttatggtaaagcccgcccttgcctac
cttgacgttatcagggccgttaaggagacctttaagtacccgactgccgcctacaacgtt
agcggcgagtactctatggtgaaggctgcggcccttaagggctggatagacgaaaagcgg
gtagtgctcgaaacccttacctctatgaagagggcgggagccgacctgattctcacctac
cacgcccttgaggcggcgaggtggttaaacgaatag

DBGET integrated database retrieval system