KEGG   Thermovibrio ammonificans: Theam_0548Help
Entry
Theam_0548        CDS       T01391                                 

Definition
acetate/CoA ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_0548
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theam_0548
   00620 Pyruvate metabolism
    Theam_0548
   00640 Propanoate metabolism
    Theam_0548
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Theam_0548
   00680 Methane metabolism
    Theam_0548
Enzymes [BR:tam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Theam_0548
Lipid biosynthesis proteins [BR:tam01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Theam_0548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(500079..501974)
Genome map
AA seq 631 aa AA seqDB search
MSKEQLDHLLKKELVIPPPEEFVKNANVKDYEAEYKRFLENPEKFWEEVAQQLIWFKKWE
KVLEWNYPYAKWFVGGKTNITVNALDRHVKGDKRNKVAFFWEDELGNEKVVTYGELYRLV
NKLANALKRAGIKKGDRVVIYMPLVIEQVAAMLACARIGAIHSVVYAGFSASALRHRIED
AEAKMVITADVTIRRGRAIPLKQIVDQAILDLPTVEKVVVLRRLRPLVDLIGEKEVDFYS
FIENEPDYCEPEEMDAEDPLFILYTSGSTGKPKGVLHTTGGYMVGTYYSVKTVFDLKEDD
VYWCTADPGWITGHSYIVYGPLVAGATQVIAEGAPNYPDFGRWWRIVEKYGVNIFYTAPT
AIRMFMRAGEEWPNKYDLSSLRLLGSVGEPINPEAWLWYYRVIGKERCPIVDTWWQTETG
AVMITTIDGLPMKPGKAGKPVPGVIADVVDKEGNPVEPEKGGFLVIKFPWPSMMRTIWKN
PQRYEQYWNTIPNCYTAGDVAVKDKDGYIMILGRADDVINVSGHRIGTMEVESALVSHPA
VAEAAVIGKPDPVKGEAIKAFVILKAGVEPSDKLVEDLKYHVKMELGALAVPSEIEFVEK
LPKTRSGKIMRRVLKARELGIDPGDLSTLED
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagaacagctcgaccacctcctaaaaaaagagctcgtaattcccccgccggag
gagttcgtcaaaaacgcaaacgtaaaagactacgaagccgagtacaagcgttttctcgaa
aaccctgaaaagttctgggaggaagtggcccagcagctaatctggttcaagaagtgggaa
aaagttttagagtggaactacccttacgccaaatggttcgtagggggcaaaaccaacata
acggttaacgccctcgaccgccacgtcaagggggacaagaggaacaaggtagccttcttc
tgggaagacgagctgggaaacgagaaagttgttacctacggagagctctacaggctcgtt
aacaaactcgcaaacgccctgaaaagggcaggcataaagaagggagacagggtagtaatc
tacatgcccctcgtaatagaacaagtagctgcaatgcttgcgtgcgcccgaataggggcg
attcactcggtagtttacgccggcttcagtgcatctgccctccgccacaggatagaggac
gcagaggccaaaatggtcataaccgccgacgttaccataagacgcggcagggccattccc
ctaaaacagatagtagaccaggcaatcctcgaccttcccacagttgaaaaggttgtcgtc
ctgaggaggctcaggcccctggtagacctcatcggcgaaaaggaggttgacttctacagc
ttcatagagaacgagcccgactactgcgaaccggaggagatggacgcagaagacccgctg
ttcatactctacacctccggctcaaccggaaagcccaaaggggtgctccacacaaccggc
ggctacatggtgggaacctactactcggtaaaaaccgttttcgaccttaaagaagacgat
gtttactggtgcaccgccgacccgggctggattacaggccacagctacatcgtttacggc
cccttagttgccggggcaacccaggttatagccgagggagctcccaactacccggacttc
ggaaggtggtggaggatagtagagaagtacggtgtgaacatcttctacacggcgcccact
gcaatcaggatgttcatgagggccggagaggagtggcccaacaagtacgacctttcgtcg
ctgaggctcctgggctcggtgggagaacccataaaccccgaagcctggctctggtactac
agggtaataggtaaggagcggtgcccgatagttgatacctggtggcagaccgaaaccggc
gccgtgatgataacaacgatagacgggctgcccatgaaacccggtaaggccggtaagccc
gtccccggagtaattgcagacgttgtcgacaaagagggcaacccggtagagcccgaaaaa
ggcggtttcctggtaataaagttcccgtggccctctatgatgagaaccatctggaagaat
cctcagcgctacgagcagtactggaatacaatccccaactgctacacggcgggagacgta
gcagttaaagataaagacggctacataatgattctcggccgtgccgacgacgttataaac
gtttccggccacagaataggaacgatggaggttgagtcggcactggtttcccacccggcg
gtagcagaggcggcagttataggaaaacccgacccggttaagggagaggcaataaaggcc
ttcgttatactgaaagccggcgttgagcccagcgataagctggtagaggaccttaagtac
cacgtaaagatggagctgggagcccttgccgttcccagcgagatagagtttgttgagaag
ctccccaaaacaaggagcggaaagataatgagaagggtcctaaaggcaagggagctcgga
atagacccgggagacctctcaacgctggaggactga

DBGET integrated database retrieval system