KEGG   Thermovibrio ammonificans: Theam_0569Help
Entry
Theam_0569        CDS       T01391                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase (EC:1.1.1.267)
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
tam  Thermovibrio ammonificans
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Theam_0569
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Theam_0569
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(519375..520466)
Genome map
AA seq 363 aa AA seqDB search
MRDCKRVFILGSTGSIGRNTLKVIEQFPDRFKVVGLVAGRNREALQLQTEKFGPERSVLV
AEEGLEAVKRALEEVEFDVAVCAITGSAGILPTYWAALKGARLALANKESLVCAGRFITE
AAREIIPVDSEHSAIFQCLVGEKQREVEEIILTASGGPFREREDLESVTPQEALKHPNWK
MGPKVTVDSATLMNKGLEVIEAFWLFKLSPERIKVVVHPQSVVHSLVRFTDQSVKAQLGV
PDMRVPIAYALSFPERLPLGEELKLNLVGQKLEFYEPDTERFPCLKLAYRALEEGYPYPI
ILNAADEVAVELFLEGKIAFTKIPRLIEKTLESSNFKEPASVEEVVQIDKRARELARQVA
KWL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttgcgagactgtaagagggtattcatcctcggctctaccggctcaatagggcgcaacacc
ctaaaggttatcgagcaattccccgacaggttcaaagttgttgggctcgtagccggcagg
aacagagaggccctgcagcttcaaaccgaaaagttcgggccggaaaggagcgttttagta
gcggaagaggggcttgaggccgttaaaagggccttagaagaggtggagttcgacgtagcg
gtgtgtgccataaccggctccgccggaatactgccgacctactgggcggcccttaaaggg
gcaagactggcccttgccaacaaggagtcgctggtctgcgccggcaggttcattaccgaa
gcggcaagggagataatcccggtagacagcgagcactcggcaatattccagtgcttagta
ggcgaaaagcaaagagaggtggaggagataatcctaaccgcctccggcggccccttcagg
gagagggaagacctggagtcggtaacgccccaagaggccctaaaacaccccaactggaag
atgggccccaaagtcaccgtagactctgcaacccttatgaacaaggggctcgaggttata
gaggccttctggctctttaaactctctccggagcggataaaggttgtggttcaccctcaa
agcgttgttcactccctcgtaaggtttaccgaccagtcggtaaaggcccagctgggagtg
cccgatatgcgggtgccgatagcctatgccctctcgttcccggaaaggctaccgctcggg
gaggagctcaagctcaacctcgtagggcagaaactggagttctacgagcccgacacggag
aggtttccctgcctgaagctcgcctacagggcccttgaagagggctacccctacccgata
atcttgaacgccgccgacgaggtggccgtagagctcttcctcgagggcaaaatcgccttt
accaagattccccgcctgatagaaaagaccttagagtcttcaaactttaaagagcccgcc
tccgttgaggaggtggttcagatagacaagcgggccagggagctcgcaaggcaggtggca
aagtggctctga

DBGET integrated database retrieval system