KEGG   Thermovibrio ammonificans: Theam_0578Help
Entry
Theam_0578        CDS       T01391                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00521  Streptomycin biosynthesis
tam00523  Polyketide sugar unit biosynthesis
tam01130  Biosynthesis of antibiotics
Module
tam_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Theam_0578
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theam_0578
Enzymes [BR:tam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Theam_0578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Cupin_4
Motif
Other DBs
NCBI-ProteinID: ADU96550
JGI: Theam_0578
UniProt: E8T5W6
Position
530780..531343
Genome map
AA seq 187 aa AA seqDB search
MPFDFKELPIPGLLLVESRLFKDGRGFFMELFKLPDFEAAGIKGPFVQDNLSLSRKNVLR
GLHYQVEPAAQGKLVTCLRGKVFDVAVDLRKGSPTFGRWFGTELFPGKMLYIPEGFAHGF
LTLSEEALVFYKVTGSPYSPEHDRSLKWNDPQIGIEWPLDGEPILSEKDRNAPSLSEAEI
NFRWREQ
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
ttgccctttgattttaaggagcttcccatccccggtcttctccttgttgagtccaggctc
tttaaagacggcaggggcttctttatggagctttttaagctccccgactttgaagcggcg
ggtataaaggggccattcgttcaggataacctctccctttccaggaagaatgtcttaaga
gggcttcactaccaggttgagcctgccgcccaaggtaagcttgtaacctgcctccggggg
aaggttttcgacgttgccgtagacctgagaaagggcagccccaccttcggcaggtggttc
ggcacagagcttttccccgggaagatgctctacatcccagaagggtttgcccacggattt
ctgaccctttcagaagaggccctcgttttctataaagttacgggaagcccctactcgccc
gagcacgacaggtctttaaagtggaacgacccccaaatcggtatagagtggcccctcgac
ggtgagcctatcctttccgaaaaagaccggaacgctccttccctctctgaagccgagata
aactttaggtggagggagcagtga

DBGET integrated database retrieval system