KEGG   Thermovibrio ammonificans: Theam_0607Help
Entry
Theam_0607        CDS       T01391                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
tam  Thermovibrio ammonificans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
557278..558354
Genome map
AA seq 358 aa AA seqDB search
MEKKIECKLLKKVRQKKKLTPSELQEITQIAKEELKFLARNNIPLIPENYILWFEIFCYL
HENGLELSDLEIMGLFKEKYPTVDNVEAVLLQVEDEDRELLKSVAQEIVTEIEKLIEVIV
DHNNTLEEKENSFKEIRNRVADSSVKDLLGQVLEELCVIRQQNEELKNKLEEANQQIKKL
TQELEQTKKEASIDFLTQVANRASFDRAITDMVNDFYRRNYPFALLMIDIDNFKKINDTY
GHQAGDYVLRELARLLKSQLRARDIIARYGGEEFAILLPGVTFSQAIRVAERLRKSVEKH
LFKYNDQVIPVTISVGVAMMRDGLDETALVEKADKALYLAKRSGKNQVKTDLDVELEE
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaaaatagagtgcaaactcctgaagaaggtgcgccagaagaagaaacttacc
ccttcggagcttcaggaaattactcaaatagccaaagaggaactgaagttcttggccagg
aacaacatacccctcataccggagaactacatcctctggtttgagatattctgctacctc
cacgaaaacggcctggagctctccgaccttgagataatgggcctctttaaggagaagtac
ccgaccgtagacaacgtagaggccgttctgcttcaagttgaagatgaagacagagagctc
ctaaagagcgtggcccaggagatagtcaccgagatagagaagctcatagaggttatagta
gaccacaacaacaccttggaggagaaggagaactccttcaaggagatacggaacagggtt
gccgacagctccgtaaaagacctcctcggtcaggttctcgaggagctctgcgtaatcagg
cagcagaacgaggagcttaagaacaagctcgaggaggccaatcagcagataaaaaagctg
acacaggagcttgagcagactaagaaagaggcctccatagacttcctcacccaggttgcc
aacagggccagcttcgacagggccataaccgacatggtgaacgacttctaccgcaggaac
taccccttcgcccttctcatgatagacatagacaacttcaagaagataaacgacacctac
ggccaccaggcgggagattacgtcctcagggagcttgcaaggctccttaaaagccagctc
agggccagggacattatagcccgttacggcggagaagagttcgcaatcctgcttccgggc
gttaccttcagccaggcgataagagttgccgagcgccttaggaagtcggtagaaaagcac
ctgttcaagtacaacgaccaggtcatacctgttacaattagcgttggcgttgccatgatg
agagacgggctcgatgaaacggctctcgttgaaaaggccgataaagccctttaccttgca
aagcgttccggtaaaaaccaggtgaaaaccgacctggacgtggagctcgaagagtga

DBGET integrated database retrieval system