KEGG   Thermovibrio ammonificans: Theam_0634Help
Entry
Theam_0634        CDS       T01391                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tam  Thermovibrio ammonificans
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tam00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(584311..584889)
Genome map
AA seq 192 aa AA seqDB search
MELPFKREREELIRVGRITFEAGLTDTHGGNISCRVGDYILIKKSGKMLGYLKPEDFVVT
TLEENPRLDRYASMELIVHRAIYRELPHVKAILHAHAPFTVACSLLYDTIVPADSEGRLL
IKEAPVLKAEKVVSSEEVARKLPKLLKEHPVAVIWSHGPFAVGGSAEEALKFLSALENSC
KILAAYSQLKGV
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
gtggagcttcccttcaaaagagaaagagaggaactcatcagggtggggcgcataaccttt
gaagccggccttacagacacccacgggggcaatatcagctgcagggtcggcgattacata
ctcataaagaagtcgggaaagatgctgggctacctgaaaccggaggacttcgttgtaaca
acccttgaagagaacccccggctcgaccgctacgcatcgatggagctcatagtccacagg
gcgatttacagggagcttccccacgtaaaggcgatactccacgcccacgcccccttcacc
gtagcgtgctcactgctctacgacacgatagtgccggcagactccgaaggccggctcctc
attaaagaggctcccgttctaaaggcggagaaggtggtatcgtcggaggaggttgcccgc
aagcttccgaaactcctgaaggagcacccggttgccgttatctggagtcacggccccttt
gcggtaggaggaagcgccgaagaagccctgaagttcctgtcggcccttgagaattcctgt
aaaattctggccgcctactcacagctcaaaggggtgtaa

DBGET integrated database retrieval system