KEGG   Thermovibrio ammonificans: Theam_0655Help
Entry
Theam_0655        CDS       T01391                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_0655
   01230 Biosynthesis of amino acids
    Theam_0655
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theam_0655
   00051 Fructose and mannose metabolism
    Theam_0655
   00562 Inositol phosphate metabolism
    Theam_0655
Enzymes [BR:tam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Theam_0655
Exosome [BR:tam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Theam_0655
  Exosomal proteins of bladder cancer cells
   Theam_0655
  Exosomal proteins of melanoma cells
   Theam_0655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(605582..606328)
Genome map
AA seq 248 aa AA seqDB search
MRRLLIAGNWKMHKTVPEAVELVRELKELVKDVTDRDILVCPPFTALYPVSQELKGSNIY
LGGQNMFYEEEGAFTGEISPLMLKDVGCRFVILGHSERRHIFKEDDRLINKKVLSAVEHG
LTPILCVGETLQERESGRTKEVVKKQVVEGLKGLTPESEFVIAYEPVWAIGTGRTATPEL
AQEVHEFIRNTLKELFGSEKAETVRILYGGSVKPNNAAGLLKMPDIDGALVGGASLKAES
FSQIVKAL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
ttgaggaggcttctcatcgccggcaactggaaaatgcacaaaaccgtgccagaggcagta
gagctggtaagggagctcaaagagctcgtaaaagacgttacagacagggacattctggta
tgcccgccctttaccgccctttacccggtatcccaggagctcaaagggagcaacatctac
ctgggtgggcagaacatgttctacgaggaggagggagcgtttaccggagagatttccccc
ctcatgttaaaagatgtagggtgccgttttgtaatactgggccactctgagaggcgccac
atctttaaagaggacgaccggctgataaacaagaaagtgctctctgcagtagagcacggc
cttacgccgattctgtgcgtaggtgagaccctacaagagcgagaaagcggcaggaccaag
gaagttgtaaaaaaacaggttgtagaaggcttgaaaggcctaaccccagaaagcgaattc
gttatagcctacgagccggtttgggccataggaaccggtagaacagcaaccccggagctc
gcccaagaagttcacgagttcataaggaacaccctgaaggagctcttcggcagtgagaag
gcggaaaccgtgaggatactctacggcggcagcgtaaagcccaacaacgccgcaggcctt
ctaaagatgcccgacatagacggagcccttgtaggcggtgcgagccttaaagctgaaagc
ttttcccagatagtgaaggcactctaa

DBGET integrated database retrieval system