KEGG   Thermovibrio ammonificans: Theam_0663Help
Entry
Theam_0663        CDS       T01391                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tam  Thermovibrio ammonificans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Theam_0663
Enzymes [BR:tam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Theam_0663
Transfer RNA biogenesis [BR:tam03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Theam_0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
613596..614375
Genome map
AA seq 259 aa AA seqDB search
MEELLNLALKASLDAGKEILDVYGSGSTEVWEKQDRSPLTEADLRSHRVIMNYLRETGYP
ILSEEGKDIPYEERRQWSRFWLVDPLDGTKEFLKRNGEFTVNVALIENGKPILGVVHAPA
LGVTYFAGVGKGAFKVESEGSPKRLPLFSPVEGVVRVVASRSHLSEETERFVESLKGKFE
RVEFVAVGSSLKLCMVAEGKADIYPRFAPTMEWDTAAGQAIVEGAGGRVVNAQTGKPLLY
NKENLLNPYFIAYRGGYEL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
ttggaggagcttctaaaccttgccttaaaggcttcgctcgatgcgggaaaagaaattctc
gacgtttacggcagcggctccaccgaggtttgggaaaagcaagaccgttccccattaacc
gaagccgacctgcgctcccatagggttatcatgaactaccttcgggaaaccggctatccg
attctctccgaggaggggaaagacataccctacgaagagaggaggcagtggagccggttc
tggcttgtagaccccctcgacggaacgaaggagttcctgaagagaaacggtgaatttacc
gttaacgttgccctgattgaaaacggaaaacccattttaggagttgttcacgctccggcc
ctcggggttacctactttgccggggtggggaagggtgcctttaaagttgaatcagagggt
agcccgaagaggctccccctcttttcgccggtagaaggcgttgttcgggtagttgcttcc
cgctcccacctttcagaagagaccgagcgtttcgttgagagtttgaagggtaagtttgag
agggttgagtttgttgcggtgggaagctcgctgaagctctgtatggttgcagaaggtaag
gcagacatctacccccgttttgcgcccaccatggagtgggatacagctgccggtcaggct
attgttgaaggagccggcggcagagtcgtaaacgcgcaaacggggaaaccgcttctttat
aacaaagaaaaccttctaaacccttacttcatagcctatagaggggggtatgagctttag

DBGET integrated database retrieval system