KEGG   Thermovibrio ammonificans: Theam_0702Help
Entry
Theam_0702        CDS       T01391                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tam  Thermovibrio ammonificans
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Theam_0702
Enzymes [BR:tam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Theam_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(649169..649594)
Genome map
AA seq 141 aa AA seqDB search
MALALLVMGSNLGNRKENLKRGKLLVERFAGPILRETPPVETAPFGVTKQPPFLNCGLLI
ETDHPPLELLRLLKWIEKRAGRYPTYRWGPRVLDVDIALYEGVKRETEELKLPHPGLKER
PFFREIARELLGGTHLLFNRL
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgccctacttgtaatggggagcaacttgggaaaccgaaaggagaacttaaag
cgggggaagctccttgtggagcggttcgcaggcccgattctaagggaaacgcccccggtt
gagaccgcacctttcggcgttaccaaacagcctcccttcttgaactgcggcctcttgatt
gagaccgaccacccgcccttagagctcctcaggctcctgaagtggatagagaaaagggcc
ggaaggtatcccacctacaggtgggggccgagggttctcgacgtggatatagccctttac
gagggagtgaagagggagacggaggagctgaagctcccccacccaggactgaaagagagg
ccgtttttcagggagatagcaagagagctcttaggtggcacacacctcctcttcaaccgg
ctctaa

DBGET integrated database retrieval system