KEGG   Thermovibrio ammonificans: Theam_0715Help
Entry
Theam_0715        CDS       T01391                                 

Definition
peptidase M20
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tam  Thermovibrio ammonificans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tam01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tam00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(660143..661207)
Genome map
AA seq 354 aa AA seqDB search
MVINLLEKLISIPSVYGNEKEIADYCEKELSGNPKLKVIRENNTLVAHTEINPEKRTVAL
VGHLDTVDVPNSKTGKVENGKLYGLGASDMKAGDAVILKIAQDLKEAESRFNLFFILYEK
EEGPYRENGLQPLFKKWKELLSKIDFAFVLEPTDNTVQVGCLGVIHAWFTFKGKRAHSAR
PWQGENAIHKSWPLLKFLSELKPKPYTVGGLTYYEVLNATMAEFEGGRNIIPESFRLNLN
YRFSPTKSLEEAQKELKELGERFGAEVTFTDLSPAARPCTDNPVLREFLSRFKVKVEPKQ
AWTDVAQLSSHGIDAVNFGPGQPHQAHQVDEWVELEKVKECYRMLGEFLFKGAS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggttataaacttgttagaaaagctaatctccattccatccgtttacggaaacgaaaaa
gagattgccgactactgtgaaaaggagctgagcgggaacccgaagctgaaggttatcagg
gagaacaatacgctggttgcccataccgaaattaacccggagaagagaaccgtagccctt
gtgggccacttagatacggtagatgttccgaacagcaaaaccggaaaagtagaaaacggt
aagctctacggccttggggccagcgatatgaaagccggagacgcggttatcctgaaaatt
gcccaagaccttaaagaggccgaaagcaggtttaacctctttttcatactctacgaaaag
gaggagggaccctacagggagaacggcctccagcccctttttaaaaagtggaaagagctt
ctttcgaaaatcgacttcgcatttgtcctcgagccaacagataacacggttcaggtgggg
tgtttgggggtcatacacgcctggttcaccttcaaggggaaaagggcccactctgcaagg
ccgtggcagggcgaaaacgccatccacaagagctggccgctccttaagttcctgagcgag
ctaaagcccaagccctacacagttggaggactcacctactacgaggttctgaacgccaca
atggcggagtttgaggggggaaggaacatcatacccgagagcttccggctcaaccttaac
taccgcttctcgcccacaaagagcttagaggaggcccaaaaggagctgaaagagctcgga
gagaggttcggagccgaagttacgtttacagacctctccccggcagcaaggccttgcacc
gataacccggtgctgagggagttcttgagtcggtttaaggtaaaagttgagccgaaacag
gcctggaccgatgttgcccagctctcaagccacggcatagacgcagtaaacttcggaccc
ggtcagcctcaccaggcccaccaggtagacgagtgggtggagctcgagaaggtaaaggag
tgctacagaatgctcggggagttcctctttaaaggagcctcttaa

DBGET integrated database retrieval system