KEGG   Thermovibrio ammonificans: Theam_0854Help
Entry
Theam_0854        CDS       T01391                                 

Definition
UDP-N-acetylmuramyl-tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tam  Thermovibrio ammonificans
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tam00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:tam00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(811954..813411)
Genome map
AA seq 485 aa AA seqDB search
MKLPHLLKGVPLLCGGAPDVEVKGITADSREVKPGFLFFAVRGTKVNGNTFAEEALKKGA
SAVVTDSRKWFEKLSAAGKPVLLVENSRKALATAAANLYGNPQKELKILGVTGTNGKTTT
TFLLFKALNRLGVKAGIIGTVSWGSEEELHPSSRTTPSAVELFKMLKELKNRGCEFVVCE
VSSHGLHQHRVHGIEFEGAIFTNLTPEHLDYHGNLEEYFLAKAKLFRLSKLSVVNRDDPY
GTTLSALRAVNGGKTVTYGKKSRNYTIEAIDPEGSVLIGTPKGAVKVKHNLKGEFNGYNV
TAAFSLLSELGFEPLNLKEAFKNVKVPGRMEEVVPGVFVDYAHTPDALQKALNALKKACS
GRLIVVFGCGGDRDRTKRPVMGKIAATLADSVIVTSDNPRSEPPEQIAKEVVAGIPEELR
GKVTVELDRKRAIELALRGKGQADYLLIAGKGHENYQEVAGKKLPFSDQETVRELYGRKN
AGGNS
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
ataaaactccctcacctccttaagggggttcccctgctgtgcgggggggctcccgacgtc
gaagttaaggggataaccgcagactcaagggaagtaaagcccggttttctcttcttcgca
gttcgggggaccaaagtcaacggcaacacctttgcagaggaagccctgaaaaaaggggcc
tcggccgttgtaaccgactcccggaagtggttcgagaagctctcggccgccgggaaaccg
gtcctgctcgttgagaactcaaggaaggcacttgcaaccgccgctgcgaacctttacggc
aacccacagaaagagctgaaaatcctgggagtaacaggaaccaacggcaaaacaacaacc
acatttctgctctttaaggctctaaacaggctcggcgtaaaagcggggataataggaacc
gtttcgtgggggagcgaagaagagctccaccccagcagcagaaccaccccttccgccgtt
gagctcttcaaaatgctgaaagagctaaaaaacaggggttgcgagtttgtggtctgcgaa
gtctcttcccacgggctccaccaacacagggtccacggcatagagtttgaaggggccata
tttacaaacctcaccccggagcacttagactaccacgggaacctcgaagagtacttcctg
gcaaaggccaagctcttcaggctcagcaaactctcggtggtaaaccgcgacgacccctac
ggaacaaccctttcggccctcagggcggtaaacggcgggaaaaccgtaacctacggcaaa
aagagcagaaactacacaatagaggcaatagaccccgaaggaagcgttctaatcggaacc
ccaaaaggagcagtaaaggtaaagcacaaccttaaaggagagtttaacggctacaacgtt
acagctgcattctccctgctctcagagctggggttcgagccgttaaacctaaaagaggcg
tttaaaaacgttaaagttccggggagaatggaagaagttgttcccggcgtgtttgtagac
tacgcccacacccccgatgccctccaaaaagccttaaacgctctgaaaaaggcctgctcc
ggcaggctcattgtcgttttcggctgcggcggagacagagacagaacgaaaaggccggta
atgggaaaaatagctgcaacccttgccgattcggtgatagtcacaagcgacaacccaaga
agcgagccgccggagcagatagccaaagaggtggttgccggaatccccgaagagctgaga
ggaaaggtaaccgtagagctggacaggaaaagggctatagagctcgccctaaggggtaaa
gggcaagcagactacctgctgattgccggtaaggggcacgaaaactaccaagaagtggcc
ggcaaaaagctaccttttagcgaccaagagacggtgagggagctctatggacgcaaaaac
gctggcggaaatagttaa

DBGET integrated database retrieval system