KEGG   Thermovibrio ammonificans: Theam_0983Help
Entry
Theam_0983        CDS       T01391                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_0983
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theam_0983
   00052 Galactose metabolism
    Theam_0983
   00500 Starch and sucrose metabolism
    Theam_0983
   00520 Amino sugar and nucleotide sugar metabolism
    Theam_0983
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Theam_0983
   00524 Butirosin and neomycin biosynthesis
    Theam_0983
Enzymes [BR:tam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Theam_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
951374..952225
Genome map
AA seq 283 aa AA seqDB search
MKLGVDVGGTFIKLYNGKNREKVKTPRSAEELVELIAGRAEELSAKGVCIAVAGLVNGET
GEVTESPNLPFLNGLNLKEEVEKRLTGTAVRVVNDATAAAYGEFKRGSGRGSRLFLCLTL
GTGLGGGAVINGEPLIGVSGSAMEVGHTTVCVNGWPCHCGRRGCLEAYASSYGLKRLYYI
NTEEDLPPHAILELAKSGDEKALKAIKALAFYLGVGITNLVHTFNPDTVALAGGTVVQFP
KLIKLVEEEVKRRAFKLPGKALKVVGAELGEFSGAVGAYELAP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgaaactgggagtagacgtaggaggaaccttcataaaactctacaacgggaaaaacaga
gagaaggtaaaaaccccccgctccgcagaggaactggtagagctgatagccggcagagca
gaggagctatcggcaaaaggggtgtgcatagccgttgcgggccttgtaaacggagagacc
ggagaggttacagagtcgccgaacctgccattcctcaacggtttaaacctgaaagaggaa
gtagagaaaaggctcacaggcacagccgtcagagtggtaaacgacgccacggcagccgcc
tacggcgagtttaaaaggggaagcggccgcggcagcaggctcttcctctgcctaacgctg
ggaaccggcttagggggcggggcggtaattaacggagagcccctcataggggtttcgggc
agtgccatggaggtcggccacacaaccgtatgcgtaaacggctggccctgccactgcggc
aggagagggtgcctggaagcctacgcctcatcctacggcttaaagcggctctactacata
aacaccgaggaagacctgcctccgcacgcaattttagagctggcaaagagcggagacgaa
aaggccttaaaggcgataaaagcccttgccttctacttgggagttggcatcaccaacctt
gtccacaccttcaaccccgacaccgtggccctggccggcggaacggttgtccagttcccg
aagctgattaagctggtagaggaagaggttaagagaagggccttcaaacttcccggcaaa
gccctgaaggtggtgggagcagagctgggagagttcagcggggcagtgggagcctacgag
ctggctccctaa

DBGET integrated database retrieval system