KEGG   Thermovibrio ammonificans: Theam_1003Help
Entry
Theam_1003        CDS       T01391                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theam_1003
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Theam_1003
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Theam_1003
Enzymes [BR:tam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Theam_1003
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
974110..975318
Genome map
AA seq 402 aa AA seqDB search
MYNYPDSLGKFGPFGGKFVPETLMAALSELEEKYRELKEDESFQSEFRKLLKQYVGRPTP
LQPAERLSEFLGNGIKVYLKREDLNHTGAHKINNALGQALLAKRMGKKRIIAETGAGQHG
VATATACAFLGLECIVYMGEEDVHRQALNVFRMELLGAKVEVVKSGSRTLKDAVNEAIRD
WVTNVRTTHYIIGSAVGPHPYPMIVRDFQSVIGKETREQILKAEGRLPDAIVACVGGGSN
AIGIFYPFIEDKEVELIGVEAGGYGLDTDKHAATLCKGKVGVFHGAKSYLLQNEDGQVTP
THSVSAGLDYPGVGPEHSLLKEVKRAQYYAVTDEEALEAFQVLSRTEGIIPALESSHAVA
WVLKNREKLKGKTVVINLSGRGDKDVNQVKEILEERPELRIW
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
ttgtacaactaccccgactccctcggaaagttcggccccttcggaggaaagttcgttccc
gaaaccttaatggcggctctttcggagcttgaggagaagtacagagagcttaaagaggac
gaaagcttccaatccgaattcagaaaactcctaaaacagtacgtaggaaggcccactccc
ctgcagcctgccgagcgcctatcggagttcctcgggaacggcattaaagtttacctgaaa
agggaagacctcaaccacaccggagcccacaaaatcaacaacgccctgggtcaggcgctc
cttgccaagagaatgggtaagaagaggataatagccgaaaccggagcaggccagcacggc
gttgcaacggctaccgcctgcgccttcctggggcttgagtgcatagtatacatgggggag
gaggacgttcacagacaggccctaaacgttttcaggatggagcttctcggcgccaaggta
gaggttgtcaaaagcggcagcagaacacttaaagacgcggtaaacgaagccataagggac
tgggtaacaaacgtcaggaccacccactacatcatcggctcggcggtaggccctcacccc
taccccatgatagttagggactttcagtcggttataggaaaggagaccagagaacagata
ctcaaagccgagggacggctgcccgacgcaatagtggcctgtgtgggcggagggagcaac
gcaatcggcatcttctaccccttcatagaagataaagaggtggaacttataggcgtagag
gctgggggctacggcctggacaccgacaaacacgcagcaaccctgtgcaagggtaaagtc
ggcgttttccacggggccaagtcctacctgctccagaacgaagacggccaggtaaccccc
acccactcggtatctgcaggcctcgactacccgggagtaggaccggagcactcactctta
aaggaggttaaaagggcccaatactacgcggtaaccgacgaagaggccctcgaggccttc
caggtactctcaagaaccgaggggataataccggcccttgaaagctcccacgccgttgcc
tgggttcttaagaacagggagaagcttaaaggtaaaacggttgtgataaacctctcggga
agaggcgataaagacgttaaccaggtaaaagagattctcgaagagcgaccggagcttaga
atatggtag

DBGET integrated database retrieval system