KEGG   Thermovibrio ammonificans: Theam_1016Help
Entry
Theam_1016        CDS       T01391                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tam  Thermovibrio ammonificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tam00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
986921..988297
Genome map
AA seq 458 aa AA seqDB search
MRVCVIGGGVSGLSTAFYLKRGGAQVKLLERENYPGGKARTYYEKGYIVESGPNGFLDGK
PDTLELVKLLGAEKLLYRSSDKARKRFIYKNGRLVRLPENPIAFLSSYLLSWKGKVRVLG
ELLVPPSEKEDETLAEFVRRRLGKEALDYLLDPMVAGIFAGDPERMSLKAAFPTIYRLER
EYGGLIRGLIAKAKEAKKKGAKSSGPAGPGGVLTSFVKGMSQFTQLLAQELGESFTPEAQ
VKTLEKKKDKWLVTYTLRGKEKSEEFDAVVLSLPAYAAAQVLKETSRELSELLASIEYSP
ISVVALGFEKRGLGHNLDGFGFLVPKVEGRKILGALWDSSVFPNRAPEGKALIRVMIGGA
RQPELALKSEEELTEIALKELKRIMKIRHYPEMVKVFRHEKGIPHYTIGHAEKVERIFKL
GRELGNLFFCNNAYKGVGINDCTKSARETAEEVLNSLC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagagtgtgcgttataggcggcggtgtttctgggctttcaaccgccttttacctaaaa
aggggcggggcccaggtgaagctcctcgagagggaaaactatccgggaggaaaggcgaga
acttactacgagaaaggctacatagttgagtcagggcccaacgggttcctcgacggcaag
cccgataccttagagctggtaaagctgctgggggccgaaaagctactctacagaagctcc
gacaaggcaaggaaaaggttcatctataaaaacggcaggcttgtaaggctgccggagaac
ccgatagcctttctctcctcctacctgctctcctggaaaggtaaggtgagagtgctggga
gagctcctcgtccccccctccgaaaaagaggacgaaaccctcgccgagtttgtaaggcgc
aggctcgggaaagaggccctcgactacctgctcgacccgatggttgccggaatatttgcc
ggcgaccccgaaaggatgagcctaaaggcggcctttcccaccatctacaggctggagagg
gagtacggcggactcatcagggggctcatagcaaaggcgaaggaggcaaagaagaaggga
gcgaaaagctcagggcccgccggcccgggaggcgtacttacctctttcgttaaggggatg
agccagtttacccagctccttgcccaagagctgggagagagcttcacccccgaagcccaa
gtaaaaaccttagagaagaaaaaagacaagtggctggtaacctacaccctccgaggtaaa
gagaaaagcgaagagttcgacgccgtggtcctctccctaccggcctacgcagccgcacag
gtgctaaaggagacctcaagggagctctcagagctacttgcctccatagagtactccccc
atatcggtagttgccctgggctttgaaaagagggggctgggccacaacctcgacggcttc
gggttcctcgtgccgaaagttgaagggaggaagattctgggagccctctgggacagctcg
gtattccccaacagggccccggaaggaaaggccctaatcagggtaatgataggcggagca
cgccagccggagcttgcactcaaaagcgaggaagagctcacagagatagccctgaaggag
ctcaagagaataatgaaaatccgccactacccggagatggtaaaggtgttccgccacgaa
aagggcattccccactacaccatcgggcacgccgaaaaagtggaaaggatattcaaactc
ggcagggagctgggcaacctcttcttctgcaacaacgcctacaaaggcgtaggtataaac
gactgcaccaaaagcgccagagaaacggcagaggaagtcctgaactccctttgttaa

DBGET integrated database retrieval system