KEGG   Thermovibrio ammonificans: Theam_1022Help
Entry
Theam_1022        CDS       T01391                                 

Definition
ATP-citrate synthase (ATP-citrate (pro-S-)-lyase)(citrate cleavage enzyme)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
tam  Thermovibrio ammonificans
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_1022
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theam_1022
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Theam_1022
Enzymes [BR:tam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Theam_1022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(995337..996638)
Genome map
AA seq 433 aa AA seqDB search
MAQRGIREYDGKRILAEHWNEYFAPEFEYDFKSVLVTPETDLDRLPEQYPWLLEMPLVAK
PDMLFGKRGKLGLILFKKEKPCDVDYETVKQWIREKMQEEVEIKGKKGKLTHFLIEPCVP
HAPEDEYYVAMTLGYDGDHIYMSAFGGIDVEENWDKVREIVIPPLATEEEIDRLIEENVP
EEIKDKEKYADFVKRLYRFFRDMHFAYLEINPLVMVGNKVYPLDFVGRVDDTAQFLVGRK
WGELEFPAGFGGELSPEEKYIKEMDEKSGASLKLTILNPEGRIWTLVAGGGASVVYADTV
ADLGYVKELANYGEYSGNPSRAETREYVKTVLDLMTRHKDPQGRPKILIIGGAIANFTDV
AKTFDGIIDAFKEYADKMKEVGVKIYVRRGGPNYEVGLAKIKKAAEELGLPIEVYGPETH
MTEIVKKALTENP
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggctcagagaggaatcagggagtacgacggcaagaggattcttgccgagcactggaac
gagtacttcgctccggagtttgagtatgactttaagtcggttctcgttactccggaaaca
gaccttgacaggcttcccgagcagtacccgtggctcttagagatgccccttgttgcaaag
cccgacatgctctttggtaagaggggtaagctggggcttattctcttcaagaaggaaaag
ccctgcgacgttgactacgagaccgttaagcagtggattagggagaagatgcaggaagag
gttgagattaagggcaagaagggtaagctgacccacttcctcattgagccctgcgttccc
cacgctccggaagatgagtactacgttgcaatgaccctcggctacgacggtgaccacatc
tacatgtctgccttcggcggaatcgacgttgaggagaactgggataaggttagggaaatc
gttatacctccgcttgcaaccgaggaggagattgacaggctgattgaggagaacgttccc
gaggagattaaagacaaggagaagtacgcagacttcgttaagcgcctctaccgcttcttc
agggatatgcattttgcctaccttgagattaacccccttgttatggtcgggaacaaagtt
tacccccttgacttcgttggaagggttgacgacactgcccagttcctcgtcggaaggaag
tggggtgagcttgagttccctgcaggttttggcggtgagctctcccccgaggagaagtac
attaaggagatggacgaaaagtccggtgcctcccttaagctaacaatcctcaatcccgag
ggaaggatttggacccttgttgcaggcggcggtgcttcggtagtttacgccgatactgtt
gcagacctcggctacgttaaggagcttgcaaactacggtgagtactccggtaacccctcg
agggccgagaccagggagtacgttaaaaccgttctcgaccttatgacacgccataaagac
cctcagggtaggccgaaaatcctcatcatcggcggtgctattgccaacttcacagacgtt
gctaagaccttcgacggaatcatcgacgccttcaaggagtacgccgacaagatgaaggaa
gtgggcgttaagatttacgttcgccgcggtggtcccaactacgaggttggacttgcaaaa
attaagaaggcagccgaagagctcggtcttccgatagaggtttacggccccgaaacccac
atgaccgaaatcgttaagaaagctcttaccgagaatccataa

DBGET integrated database retrieval system