KEGG   Thermovibrio ammonificans: Theam_1095Help
Entry
Theam_1095        CDS       T01391                                 

Definition
branched-chain amino acid aminotransferase
Orthology
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
tam  Thermovibrio ammonificans
Pathway
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:tam01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tam01230]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:tam00280]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:tam00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:tam00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1077969..1078883
Genome map
AA seq 304 aa AA seqDB search
MGRFAYFEGKFVPVEEANINIQTNSFHYGTAVFEGIRAYWNEEKKQLFGLFVKEHYERML
ANCKILNLKVEKSAQELTEITVELLRRCGHREDTYIRPIAYFADLKISPKLIGYKTELAI
YTVPLGDYLDLSRGLKAKTASWHRINDTMIPARCKVAGAYVNSAFAKTEALLNGYDEAIM
LNPDGTVAEGSGENVFIVRNGKLITTPSASNILEGITRNAVIHLAREELGIEVEERPILR
SELYVADEVFYTGTAAQVAPVVQVDHVVIGNGEVGPVTKRLQEIYFSIVKGNNPKYEHWL
TPVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggtttgcttactttgagggcaagttcgtcccggtagaggaggcaaacataaac
atccagaccaactccttccactacggaaccgcagtttttgaaggtataagggcctactgg
aacgaagagaaaaagcagctcttcggactctttgttaaggaacactacgaaaggatgctt
gcaaactgcaagatactgaacttaaaagttgagaaaagcgcccaggagcttaccgagatt
accgtagagctactacgccgctgcggccacagggaagacacctacatcaggccgatagcc
tactttgcagacctgaaaatctctccgaagctcatcggttacaaaacagagctggcaata
tacaccgttcccttaggagactacctggacctttcaaggggcttaaaggccaaaactgca
tcgtggcacaggataaacgacaccatgattccggcccgctgtaaagttgccggagcatac
gtaaacagtgcctttgcaaaaacggaggccctcctaaacggctacgacgaggcgataatg
ctcaaccccgacggaacggttgccgaaggtagcggagaaaacgtctttatagtgagaaac
ggcaaactcataaccaccccttcggcctcgaacatactggaagggataacgaggaatgcc
gttatccaccttgcaagggaagagctcggaatagaggttgaagagcggccgattttaaga
agtgaactctacgttgcagacgaggtcttctacaccggaacggcagcacaggttgccccc
gtggtgcaggttgaccacgttgtaataggaaacggcgaggtagggccggtaacaaagagg
ctacaggaaatctacttctcgatagtaaagggcaacaaccccaaatatgaacactggtta
actccggtttactaa

DBGET integrated database retrieval system