KEGG   Thermovibrio ammonificans: Theam_1095Help
Entry
Theam_1095        CDS       T01391                                 

Definition
branched-chain amino acid aminotransferase
Orthology
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
tam  Thermovibrio ammonificans
Pathway
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Theam_1095
   01230 Biosynthesis of amino acids
    Theam_1095
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Theam_1095
   00290 Valine, leucine and isoleucine biosynthesis
    Theam_1095
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Theam_1095
Enzymes [BR:tam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Theam_1095
Amino acid related enzymes [BR:tam01007]
 Aminotransferase (transaminase)
  Class IV
   Theam_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1077969..1078883
Genome map
AA seq 304 aa AA seqDB search
MGRFAYFEGKFVPVEEANINIQTNSFHYGTAVFEGIRAYWNEEKKQLFGLFVKEHYERML
ANCKILNLKVEKSAQELTEITVELLRRCGHREDTYIRPIAYFADLKISPKLIGYKTELAI
YTVPLGDYLDLSRGLKAKTASWHRINDTMIPARCKVAGAYVNSAFAKTEALLNGYDEAIM
LNPDGTVAEGSGENVFIVRNGKLITTPSASNILEGITRNAVIHLAREELGIEVEERPILR
SELYVADEVFYTGTAAQVAPVVQVDHVVIGNGEVGPVTKRLQEIYFSIVKGNNPKYEHWL
TPVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggtttgcttactttgagggcaagttcgtcccggtagaggaggcaaacataaac
atccagaccaactccttccactacggaaccgcagtttttgaaggtataagggcctactgg
aacgaagagaaaaagcagctcttcggactctttgttaaggaacactacgaaaggatgctt
gcaaactgcaagatactgaacttaaaagttgagaaaagcgcccaggagcttaccgagatt
accgtagagctactacgccgctgcggccacagggaagacacctacatcaggccgatagcc
tactttgcagacctgaaaatctctccgaagctcatcggttacaaaacagagctggcaata
tacaccgttcccttaggagactacctggacctttcaaggggcttaaaggccaaaactgca
tcgtggcacaggataaacgacaccatgattccggcccgctgtaaagttgccggagcatac
gtaaacagtgcctttgcaaaaacggaggccctcctaaacggctacgacgaggcgataatg
ctcaaccccgacggaacggttgccgaaggtagcggagaaaacgtctttatagtgagaaac
ggcaaactcataaccaccccttcggcctcgaacatactggaagggataacgaggaatgcc
gttatccaccttgcaagggaagagctcggaatagaggttgaagagcggccgattttaaga
agtgaactctacgttgcagacgaggtcttctacaccggaacggcagcacaggttgccccc
gtggtgcaggttgaccacgttgtaataggaaacggcgaggtagggccggtaacaaagagg
ctacaggaaatctacttctcgatagtaaagggcaacaaccccaaatatgaacactggtta
actccggtttactaa

DBGET integrated database retrieval system