KEGG   Thermovibrio ammonificans: Theam_1095Help
Entry
Theam_1095        CDS       T01391                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  
branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
tam  Thermovibrio ammonificans
Pathway
Cysteine and methionine metabolism
Valine, leucine and isoleucine degradation
Valine, leucine and isoleucine biosynthesis
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Pantothenate biosynthesis, valine/L-aspartate => pantothenate
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Theam_1095
   01230 Biosynthesis of amino acids
    Theam_1095
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Theam_1095
   00280 Valine, leucine and isoleucine degradation
    Theam_1095
   00290 Valine, leucine and isoleucine biosynthesis
    Theam_1095
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Theam_1095
Enzymes [BR:tam01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Theam_1095
Amino acid related enzymes [BR:tam01007]
 Aminotransferase (transaminase)
  Class IV
   Theam_1095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1077969..1078883
Genome map
AA seq 304 aa AA seqDB search
MGRFAYFEGKFVPVEEANINIQTNSFHYGTAVFEGIRAYWNEEKKQLFGLFVKEHYERML
ANCKILNLKVEKSAQELTEITVELLRRCGHREDTYIRPIAYFADLKISPKLIGYKTELAI
YTVPLGDYLDLSRGLKAKTASWHRINDTMIPARCKVAGAYVNSAFAKTEALLNGYDEAIM
LNPDGTVAEGSGENVFIVRNGKLITTPSASNILEGITRNAVIHLAREELGIEVEERPILR
SELYVADEVFYTGTAAQVAPVVQVDHVVIGNGEVGPVTKRLQEIYFSIVKGNNPKYEHWL
TPVY
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggtttgcttactttgagggcaagttcgtcccggtagaggaggcaaacataaac
atccagaccaactccttccactacggaaccgcagtttttgaaggtataagggcctactgg
aacgaagagaaaaagcagctcttcggactctttgttaaggaacactacgaaaggatgctt
gcaaactgcaagatactgaacttaaaagttgagaaaagcgcccaggagcttaccgagatt
accgtagagctactacgccgctgcggccacagggaagacacctacatcaggccgatagcc
tactttgcagacctgaaaatctctccgaagctcatcggttacaaaacagagctggcaata
tacaccgttcccttaggagactacctggacctttcaaggggcttaaaggccaaaactgca
tcgtggcacaggataaacgacaccatgattccggcccgctgtaaagttgccggagcatac
gtaaacagtgcctttgcaaaaacggaggccctcctaaacggctacgacgaggcgataatg
ctcaaccccgacggaacggttgccgaaggtagcggagaaaacgtctttatagtgagaaac
ggcaaactcataaccaccccttcggcctcgaacatactggaagggataacgaggaatgcc
gttatccaccttgcaagggaagagctcggaatagaggttgaagagcggccgattttaaga
agtgaactctacgttgcagacgaggtcttctacaccggaacggcagcacaggttgccccc
gtggtgcaggttgaccacgttgtaataggaaacggcgaggtagggccggtaacaaagagg
ctacaggaaatctacttctcgatagtaaagggcaacaaccccaaatatgaacactggtta
actccggtttactaa

DBGET integrated database retrieval system