KEGG   Thermovibrio ammonificans: Theam_1119Help
Entry
Theam_1119        CDS       T01391                                 

Definition
coenzyme F420 hydrogenase/dehydrogenase beta subunit domain protein
Orthology
K00441  
coenzyme F420 hydrogenase subunit beta [EC:1.12.98.1]
Organism
tam  Thermovibrio ammonificans
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Theam_1119
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.12  Acting on hydrogen as donor
   1.12.98  With other, known, acceptors
    1.12.98.1  coenzyme F420 hydrogenase
     Theam_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1099558..1100442
Genome map
AA seq 294 aa AA seqDB search
MLNLNREFLIGEFKRAFKVESREGTPLERLFKLMFKSRMIDGLLTANREGTPILAKDEKE
VEINRLNRFFGVNKLLKTAIQKHRLNKLAIFGPSCLIDGLNKAQYFGIGCNWAKTAVALK
VGLLCLGSTTKEAAEAEMLEITGRRLTPVKSYIDGGKLITETAEGEEVELEPAVHHYYSN
TACRYCLNLCAKGSDLTYVPLKGEKEALFIVRSERGWRTLAQVQQKFPGELLFKPENGEL
DRISALLKEKMLHNVAEIIERVELGLPVPKWSDNKLRKFYRAWNSVENREEEVF
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaccttaacagagagttcctcataggagagttcaaaagggcgtttaaggtagag
tcccgggaaggaacgccccttgagaggctcttcaagctgatgtttaagtcccgaatgata
gacggccttctaacggccaaccgggagggaacccctattctggcaaaagacgaaaaagag
gtagagataaacaggctcaacaggttcttcggggttaacaaactgctgaaaacggcaata
cagaaacaccggctaaacaagcttgcaatcttcggcccctcctgcctaatcgacggcctg
aacaaggcccagtacttcggtatagggtgcaactgggcgaaaacagccgtggcgctgaaa
gtgggcctcctgtgcctcgggagcacaaccaaggaggcggccgaggccgaaatgctcgaa
atcacaggcagaaggctcacaccggttaagagctacatagacggaggcaaactgataacc
gaaacggcagagggagaggaggtagagttagagcccgccgtccaccactactactccaat
accgcctgtagatactgcctcaacctgtgtgccaaggggagcgacctcacctacgttccc
cttaaaggggagaaggaggccctgttcatagtgaggagcgagagggggtggaggaccctt
gcccaggttcaacagaagttccccggggagctactgtttaaaccggaaaacggagagctt
gatagaatttccgctctcctaaaagagaaaatgctccacaacgttgcagaaatcatagag
cgggtagagctcgggcttcccgttcccaagtggagcgacaacaaactgcggaagttctac
agggcgtggaactccgtagaaaacagagaagaggaggtgttctaa

DBGET integrated database retrieval system