KEGG   Thermovibrio ammonificans: Theam_1156Help
Entry
Theam_1156        CDS       T01391                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
tam  Thermovibrio ammonificans
Brite
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Theam_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrome_CBB3 Cytochrom_C DUF1924 GPAT_N
Motif
Other DBs
NCBI-ProteinID: ADU97120
JGI: Theam_1156
UniProt: E8T2M5
Position
complement(1133656..1134900)
Genome map
AA seq 414 aa AA seqDB search
MKRLLAALTISLLSATASFAGVWETNCSGCHNGTVAPSKEQLLKKFHTKQEFMAAVRKMV
QAGKMPPGLRYGMAARELFGGAPSFGAKKGVKFHSFSSATTKASSADPYAKYKKFFTPLP
ALPPIPADNALTPAKVKLGKMLYYDPRLSRSKLISCNTCHNLAIGGDDNLPTSRGDHWRT
GGRNAPTTLNSGFLRVQFWDGRAPTLEAQAKGPIQAHVEMNSTPEIVVRRLKAIPEYVKL
FKEAFPGEKDPVTFDNVAKAIAAFERTLNTPNSPFQRYLLGDENALTKEQKEGMALFVKF
GCTACHNGPVLSDGQFHKFKWNNDLGRYRVTKNPADKYKFRTAQLLNVGVTAPYFHDGSV
NSLEEAVKIMAQKELGKKLTDEQAEKIAAFLRSLTGEVPLEARTVPQLPGNNPE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaagagactccttgccgctctcaccatatcgcttctttctgcaactgcctcctttgcc
ggcgtttgggagacaaactgtagcggttgtcacaacgggactgtagcgccttcaaaggag
cagcttctcaagaagttccatactaagcaggagtttatggccgcagttcgtaagatggtt
caggccggtaagatgcctcccggcttaaggtacggcatggcagcccgtgagcttttcggc
ggagctccctctttcggagccaaaaaaggggtaaagttccactccttcagctctgcaaca
actaaggcctcttcggccgacccttacgccaagtataaaaagttcttcacaccccttccc
gcccttccgcccatccctgcagataacgcccttacccctgccaaggtgaagctcggtaag
atgctctactacgacccgaggctctcaaggagcaagcttatctcctgtaacacctgccac
aacctggccataggcggagacgataacctgcccacttccaggggagaccactggagaacc
ggaggaaggaacgctcccacaaccttgaactccggctttttaagggttcagttctgggac
ggtagggcaccaacgcttgaggctcaggcaaagggtccgatacaggcccacgtagagatg
aactctacgcccgagattgttgtccgcaggcttaaagcgatacccgagtacgtgaagctc
tttaaagaggctttccccggagagaaagaccctgtgacctttgacaacgttgcaaaggcc
atagcggcctttgagagaaccctcaatactcccaactctcccttccagcgctacctcctc
ggagacgagaacgccctcaccaaggagcagaaggagggaatggcactttttgttaagttc
ggctgtacggcttgccacaacggtccggtcctctccgacggtcagttccacaagtttaag
tggaacaacgacttgggccgctacagggtaactaagaaccccgccgataagtacaagttc
cgcaccgcccagctgcttaacgttggagttaccgctccctacttccacgacggttctgta
aacagcctggaagaagcggttaagattatggcccagaaggagctcggtaagaagcttacc
gacgagcaggccgaaaagattgccgcattcctccgctcccttacgggagaagttcccctc
gaggcaagaacggttcctcagctgcccgggaacaaccccgagtaa

DBGET integrated database retrieval system