KEGG   Thermovibrio ammonificans: Theam_1156Help
Entry
Theam_1156        CDS       T01391                                 

Definition
Cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tam  Thermovibrio ammonificans
Brite
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Theam_1156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1133656..1134900)
Genome map
AA seq 414 aa AA seqDB search
MKRLLAALTISLLSATASFAGVWETNCSGCHNGTVAPSKEQLLKKFHTKQEFMAAVRKMV
QAGKMPPGLRYGMAARELFGGAPSFGAKKGVKFHSFSSATTKASSADPYAKYKKFFTPLP
ALPPIPADNALTPAKVKLGKMLYYDPRLSRSKLISCNTCHNLAIGGDDNLPTSRGDHWRT
GGRNAPTTLNSGFLRVQFWDGRAPTLEAQAKGPIQAHVEMNSTPEIVVRRLKAIPEYVKL
FKEAFPGEKDPVTFDNVAKAIAAFERTLNTPNSPFQRYLLGDENALTKEQKEGMALFVKF
GCTACHNGPVLSDGQFHKFKWNNDLGRYRVTKNPADKYKFRTAQLLNVGVTAPYFHDGSV
NSLEEAVKIMAQKELGKKLTDEQAEKIAAFLRSLTGEVPLEARTVPQLPGNNPE
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaagagactccttgccgctctcaccatatcgcttctttctgcaactgcctcctttgcc
ggcgtttgggagacaaactgtagcggttgtcacaacgggactgtagcgccttcaaaggag
cagcttctcaagaagttccatactaagcaggagtttatggccgcagttcgtaagatggtt
caggccggtaagatgcctcccggcttaaggtacggcatggcagcccgtgagcttttcggc
ggagctccctctttcggagccaaaaaaggggtaaagttccactccttcagctctgcaaca
actaaggcctcttcggccgacccttacgccaagtataaaaagttcttcacaccccttccc
gcccttccgcccatccctgcagataacgcccttacccctgccaaggtgaagctcggtaag
atgctctactacgacccgaggctctcaaggagcaagcttatctcctgtaacacctgccac
aacctggccataggcggagacgataacctgcccacttccaggggagaccactggagaacc
ggaggaaggaacgctcccacaaccttgaactccggctttttaagggttcagttctgggac
ggtagggcaccaacgcttgaggctcaggcaaagggtccgatacaggcccacgtagagatg
aactctacgcccgagattgttgtccgcaggcttaaagcgatacccgagtacgtgaagctc
tttaaagaggctttccccggagagaaagaccctgtgacctttgacaacgttgcaaaggcc
atagcggcctttgagagaaccctcaatactcccaactctcccttccagcgctacctcctc
ggagacgagaacgccctcaccaaggagcagaaggagggaatggcactttttgttaagttc
ggctgtacggcttgccacaacggtccggtcctctccgacggtcagttccacaagtttaag
tggaacaacgacttgggccgctacagggtaactaagaaccccgccgataagtacaagttc
cgcaccgcccagctgcttaacgttggagttaccgctccctacttccacgacggttctgta
aacagcctggaagaagcggttaagattatggcccagaaggagctcggtaagaagcttacc
gacgagcaggccgaaaagattgccgcattcctccgctcccttacgggagaagttcccctc
gaggcaagaacggttcctcagctgcccgggaacaaccccgagtaa

DBGET integrated database retrieval system