KEGG   Thermovibrio ammonificans: Theam_1327Help
Entry
Theam_1327        CDS       T01391                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
tam  Thermovibrio ammonificans
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Theam_1327
  Amino acid metabolism
   00340 Histidine metabolism
    Theam_1327
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Theam_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1298537..1299868
Genome map
AA seq 443 aa AA seqDB search
MKVVNLRKENWQKDPDLLRIKTRGQGLESRYAPAVLEIIENVRQFRDTAVFGYAKKFDRV
ELTPENVKVSEREIEEAFNRVPKEVVKAIEFAVERVRRFHEHQKENSYFVTEPGIVLGQK
VTPLDSAGIYVPGGKASYPSSVVMNAVPAKVAGVEKVVMITPAIGSLEVNPYTLVAAKLS
GVNEIYRVGGAHGVAAVAFGTESIPKVDKIVGPGNIYVALAKKFLFGTVDIDMVAGPSEI
LVIADESANPDWVATDLLSQAEHDELAGAFLVTHSDRVAQEVVKAVEEKLKKLSRKEIAR
KAIENFGTVFLTEDVNHSCDVANEIAPEHLEVATKEPFGLLDRIKHAGAIFLGHYTCESL
GDYVLGPNHVLPTGGSARFFSPLGVYDFIKRSSVIYVTPEGFKQVGWAARELAECEGLEA
HRLAVEVREAFKIIAKSLAEEKR
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgttaaccttcgcaaagagaactggcagaaagaccccgacctcctgagaata
aaaaccagagggcagggcttagagagcagatacgcacctgccgttctggagataatcgaa
aacgttaggcagttcagggacacagccgtattcggctacgcaaagaagttcgaccgagta
gagctcacccccgagaacgtaaaggtctccgaaagggagatagaggaggccttcaacaga
gttccaaaagaggtggtaaaggcgatagagttcgccgtagagcgggtcaggcggttccac
gagcaccaaaaggagaactcctactttgtaacagagcccggaatagtgctgggtcagaaa
gttacaccgctggactctgccggcatctacgttccgggaggaaaggcctcttacccctct
tcggtggttatgaacgccgtacccgcaaaggttgcaggcgttgaaaaggttgtaatgata
accccggcaataggctccctcgaggtcaacccctacacgctggttgccgcgaagctctcg
ggagtaaacgagatatacagagtaggaggcgcccacggggttgcggcggtagccttcgga
acagagtccattcccaaggtagacaaaatagttgggccggggaacatatacgtggcactg
gccaagaagttcctcttcggcaccgtagatatagacatggttgccggacccagcgaaatc
ctggtaatagccgatgagtctgcaaaccccgactgggttgcaaccgacctcctctctcaa
gccgagcacgacgagcttgcaggggcgttcctcgtaacccacagcgaccgggtagcccag
gaggttgttaaggcggttgaggaaaagctgaagaagctctcccgtaaggagatagcccga
aaagccatagagaacttcggaacggtattccttacagaagacgtaaaccactcctgcgac
gtggcaaacgagattgccccggaacacctggaggttgcaacgaaggagcctttcggcctg
ctggaccggattaaacacgcaggtgccatattcttaggacactacacctgcgagagcctg
ggcgactacgtattggggccgaaccacgtcctcccgaccggaggaagcgcaaggttcttc
tcacccctgggcgtttacgacttcataaagcgctcctcggtaatctacgtaactcccgaa
gggttcaagcaggtgggctgggccgcaagggagcttgcagagtgcgaggggcttgaagcc
cacaggcttgcagttgaagttcgcgaagccttcaagataattgccaagtcgttagcagag
gaaaagagatga

DBGET integrated database retrieval system