KEGG   Thermovibrio ammonificans: Theam_1328Help
Entry
Theam_1328        CDS       T01391                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tam  Thermovibrio ammonificans
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Theam_1328
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Theam_1328
Enzymes [BR:tam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Theam_1328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1299865..1300800
Genome map
AA seq 311 aa AA seqDB search
MRDLICAQQITPELFSEIYETALKVKEALRRGRKKFSTLRGKCVVNLFFEPSTRTRTSFE
KAGKFLSADVINVSASASSVKKGESLIDTVRTLDSMHPDVIVLRHPCEGAPQTVKKFTRA
SIINAGDGRHQHPTQALLDAVTLKEHLKELKGKRITIIGDIANSRVARSDAALLKSLGAE
VAVFGPSTMMPRYPEALGVKKLNSFEEVAAFSDAVILLRIQLERQNAKKTFPSIREYATL
FGLNGQKLAKLLPHTLILHPGPFNRGVELNNAVVESPRSLIFNQVETGLAVRMVVLSMVC
NRIDQLKEEVQ
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagagacctcatctgtgcccagcagataacaccggagctcttttcagagatatacgaa
accgccctaaaggtaaaagaggccctaagaaggggcaggaagaagttctcaaccctaagg
ggaaagtgcgtagttaacctcttttttgaaccctcaaccagaaccagaacctcctttgag
aaggccggaaagttcctctcggccgacgttataaacgtgagcgcctcggcaagctccgtt
aaaaagggcgaaagcctcatagatacagtgagaaccctcgactcaatgcacccggacgta
atagtcctccgccacccgtgtgaaggggcaccccaaacagtcaaaaagtttacaagggcc
tccatcattaacgccggagacggacgccaccagcaccccacccaagccctgctcgacgcc
gttacactcaaagagcaccttaaagagctaaagggaaagcggataaccataatcggcgac
atagcaaacagcagggtggcccgttccgacgcggcactgctaaagagcctcggagcggaa
gtggcggttttcggtccctctaccatgatgccccggtatcccgaagcgctgggagttaaa
aaactcaactcctttgaagaggtggcggccttctcagacgcagtaatcctgctgaggatt
cagctggagaggcagaacgccaagaaaaccttcccctccataagggagtacgcaaccctg
tttgggctgaacggccaaaagctggcaaaactccttccccacaccctcatactccacccc
ggccccttcaacaggggagttgagctgaacaacgcagttgtagagtcaccccgctccctc
atattcaaccaggtggaaacgggccttgcagtaaggatggtggtgctgtcgatggtgtgt
aatcgcatagaccaactcaaggaggaagtgcaatga

DBGET integrated database retrieval system