KEGG   Thermovibrio ammonificans: Theam_1394Help
Entry
Theam_1394        CDS       T01391                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:tam01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tam00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tam00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tam00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tam00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tam00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:tam00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:tam00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:tam00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1360847..1361143)
Genome map
AA seq 98 aa AA seqDB search
MIGKSWRDLPIGAVIPEPGSSEKYNTGEWRAWRPVFEQDKCVNCMLCWVFCPDSCILVKE
EKMVGIDYDHCKGCGICAFECPTKALEMKPEYLFREED
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgattgggaagagctggagagatttaccgattggagcggttatacccgagcccggttcc
agtgagaagtacaacaccggtgagtggagggcttggaggcccgtttttgagcaggataag
tgcgttaactgtatgctctgctgggttttctgtcccgactcctgcattctggtgaaagag
gagaagatggtcgggatagactacgaccactgcaagggctgcggtatctgtgcctttgag
tgcccgacgaaggcccttgagatgaaacccgaatacctgttccgtgaggaggactaa

DBGET integrated database retrieval system