KEGG   Thermovibrio ammonificans: Theam_1394Help
Entry
Theam_1394        CDS       T01391                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00010  Glycolysis / Gluconeogenesis
tam00020  Citrate cycle (TCA cycle)
tam00620  Pyruvate metabolism
tam00633  Nitrotoluene degradation
tam00640  Propanoate metabolism
tam00650  Butanoate metabolism
tam00680  Methane metabolism
tam00720  Carbon fixation pathways in prokaryotes
tam01100  Metabolic pathways
tam01120  Microbial metabolism in diverse environments
tam01130  Biosynthesis of antibiotics
tam01200  Carbon metabolism
Module
tam_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
tam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theam_1394
   00020 Citrate cycle (TCA cycle)
    Theam_1394
   00620 Pyruvate metabolism
    Theam_1394
   00640 Propanoate metabolism
    Theam_1394
   00650 Butanoate metabolism
    Theam_1394
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Theam_1394
   00680 Methane metabolism
    Theam_1394
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Theam_1394
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Theam_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_2 Fer4_16 Fer4_6 Fer4_7 Fer4_10 Fer4_13 Fer4_9 Fer4_15 Fer4_17 Fer4_8 Fer4_4
Motif
Other DBs
NCBI-ProteinID: ADU97357
JGI: Theam_1394
UniProt: E8T3V0
Position
complement(1360847..1361143)
Genome map
AA seq 98 aa AA seqDB search
MIGKSWRDLPIGAVIPEPGSSEKYNTGEWRAWRPVFEQDKCVNCMLCWVFCPDSCILVKE
EKMVGIDYDHCKGCGICAFECPTKALEMKPEYLFREED
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgattgggaagagctggagagatttaccgattggagcggttatacccgagcccggttcc
agtgagaagtacaacaccggtgagtggagggcttggaggcccgtttttgagcaggataag
tgcgttaactgtatgctctgctgggttttctgtcccgactcctgcattctggtgaaagag
gagaagatggtcgggatagactacgaccactgcaagggctgcggtatctgtgcctttgag
tgcccgacgaaggcccttgagatgaaacccgaatacctgttccgtgaggaggactaa

DBGET integrated database retrieval system