KEGG   Thermovibrio ammonificans: Theam_1394Help
Entry
Theam_1394        CDS       T01391                                 

Definition
pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tam  Thermovibrio ammonificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_1394
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Theam_1394
   00020 Citrate cycle (TCA cycle)
    Theam_1394
   00620 Pyruvate metabolism
    Theam_1394
   00640 Propanoate metabolism
    Theam_1394
   00650 Butanoate metabolism
    Theam_1394
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Theam_1394
   00680 Methane metabolism
    Theam_1394
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Theam_1394
Enzymes [BR:tam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Theam_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1360847..1361143)
Genome map
AA seq 98 aa AA seqDB search
MIGKSWRDLPIGAVIPEPGSSEKYNTGEWRAWRPVFEQDKCVNCMLCWVFCPDSCILVKE
EKMVGIDYDHCKGCGICAFECPTKALEMKPEYLFREED
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atgattgggaagagctggagagatttaccgattggagcggttatacccgagcccggttcc
agtgagaagtacaacaccggtgagtggagggcttggaggcccgtttttgagcaggataag
tgcgttaactgtatgctctgctgggttttctgtcccgactcctgcattctggtgaaagag
gagaagatggtcgggatagactacgaccactgcaagggctgcggtatctgtgcctttgag
tgcccgacgaaggcccttgagatgaaacccgaatacctgttccgtgaggaggactaa

DBGET integrated database retrieval system