KEGG   Thermovibrio ammonificans: Theam_1396Help
Entry
Theam_1396        CDS       T01391                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tam  Thermovibrio ammonificans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tam03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1361706..1362311)
Genome map
AA seq 201 aa AA seqDB search
MIYPENLELLIEYLAEVPGISERAAERAVLLLSRLPEERRRQVINAFRELEQVTPCKECG
LPAAGELCRVCSDPERSRTTICVVEQPRDAISIEKLGEYKGLYHVLGGVISPLEGIGPED
LNVKSLFERIKRLGVKEVIIALNPTVEGEATAKFLVDRLQKLGVKVFRIGYGIPYGGTID
NADELTLKRAFEDKKLIAGGR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
ttgatttaccccgagaaccttgagcttctcatagagtaccttgcggaggttccgggcatc
agcgagcgggccgcagagcgggccgttttgcttctctcccgcctgcccgaagagcgcagg
cgtcaggttataaacgccttcagggagctcgagcaggtaactccctgtaaggagtgcggc
cttccggccgccggagagctgtgtagggtctgtagcgacccggagaggagcagaactacc
atctgcgttgttgaacagcccagggacgccatatcgattgagaagctcggcgagtacaag
ggcctttaccacgttctcggcggggttatctcgccccttgaagggataggcccagaagac
cttaacgtgaagtcgctctttgagaggataaagaggctcggcgttaaagaggtgataatc
gcccttaaccctaccgttgagggggaagcaaccgccaagttcctcgttgacaggcttcag
aagctcggtgttaaagtgttcagaatcggctacggcataccctacggcggaaccatagac
aacgccgacgaactgaccctgaagagggcctttgaggataagaaactaatagctggagga
cggtaa

DBGET integrated database retrieval system