KEGG   Thermovibrio ammonificans: Theam_1402Help
Entry
Theam_1402        CDS       T01391                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00230  Purine metabolism
tam01100  Metabolic pathways
Module
tam_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Theam_1402
Enzymes [BR:tam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Theam_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 AAA_22 Thymidylate_kin AAA_16 T2SSE AAA NTPase_1 MobB Tmemb_cc2 RNA_helicase ABC_tran AAA_25 FNIP Cro FANCF
Motif
Other DBs
NCBI-ProteinID: ADU97365
JGI: Theam_1402
UniProt: E8T436
Position
1367304..1367987
Genome map
AA seq 227 aa AA seqDB search
MWSNKLKGLLIVVSAPSGTGKTTLCHMLLKEIPTLEFSVSYTTRPPREGEVDGRDYHFVT
KEQFERMIEEGDFLEWANVYGNLYGTSKSQVLKALEEGRDILLDIDTQGALQVKKNFPEA
VLIFILPPSLEELERRLRKRGTDPEEVIERRLKTAREELKKALCYDYLVVNDELEKAFDQ
LKGIITAEKLKSERLEGQLNRLVKDPKVVELVEEGKGCREELLKPGK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtaacaagctcaaagggctcctcatagttgtatcggctccgtccggcaccggc
aaaacaaccttgtgccacatgctcttaaaggagatacccacccttgagttctccgtttcc
tacacaacaaggccgccccgggaaggggaggtagacggcagagactaccacttcgtaacg
aaagagcagttcgagaggatgatagaggagggcgacttcctggagtgggcaaacgtttac
ggaaacctctacggaacctccaaaagccaggttctaaaagccctcgaggagggaagggac
atactgctcgacatagacacccagggggccctccaggtgaagaagaacttccccgaagcc
gttctcatctttatccttcccccgtcgctggaagagctcgaaaggcggctgagaaagagg
ggaaccgacccggaagaggtgatagagcgcaggctcaaaaccgcacgggaggagcttaaa
aaggccctctgctacgactacctggttgtgaacgacgagctggagaaggccttcgaccag
ctcaaagggataataacggcagagaagctcaagagcgaaaggctcgaaggccagctgaac
aggctggtgaaagaccccaaggtggttgagctggttgaagagggtaaggggtgcagagag
gagcttctcaaacccggaaagtaa

DBGET integrated database retrieval system