KEGG   Thermovibrio ammonificans: Theam_1402Help
Entry
Theam_1402        CDS       T01391                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
tam  Thermovibrio ammonificans
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tam00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1367304..1367987
Genome map
AA seq 227 aa AA seqDB search
MWSNKLKGLLIVVSAPSGTGKTTLCHMLLKEIPTLEFSVSYTTRPPREGEVDGRDYHFVT
KEQFERMIEEGDFLEWANVYGNLYGTSKSQVLKALEEGRDILLDIDTQGALQVKKNFPEA
VLIFILPPSLEELERRLRKRGTDPEEVIERRLKTAREELKKALCYDYLVVNDELEKAFDQ
LKGIITAEKLKSERLEGQLNRLVKDPKVVELVEEGKGCREELLKPGK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtggagtaacaagctcaaagggctcctcatagttgtatcggctccgtccggcaccggc
aaaacaaccttgtgccacatgctcttaaaggagatacccacccttgagttctccgtttcc
tacacaacaaggccgccccgggaaggggaggtagacggcagagactaccacttcgtaacg
aaagagcagttcgagaggatgatagaggagggcgacttcctggagtgggcaaacgtttac
ggaaacctctacggaacctccaaaagccaggttctaaaagccctcgaggagggaagggac
atactgctcgacatagacacccagggggccctccaggtgaagaagaacttccccgaagcc
gttctcatctttatccttcccccgtcgctggaagagctcgaaaggcggctgagaaagagg
ggaaccgacccggaagaggtgatagagcgcaggctcaaaaccgcacgggaggagcttaaa
aaggccctctgctacgactacctggttgtgaacgacgagctggagaaggccttcgaccag
ctcaaagggataataacggcagagaagctcaagagcgaaaggctcgaaggccagctgaac
aggctggtgaaagaccccaaggtggttgagctggttgaagagggtaaggggtgcagagag
gagcttctcaaacccggaaagtaa

DBGET integrated database retrieval system