KEGG   Thermovibrio ammonificans: Theam_1408Help
Entry
Theam_1408        CDS       T01391                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tam  Thermovibrio ammonificans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_1408
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theam_1408
   00640 Propanoate metabolism
    Theam_1408
   00660 C5-Branched dibasic acid metabolism
    Theam_1408
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Theam_1408
Enzymes [BR:tam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Theam_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1373052..1374221
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQAKEIFKKYGLPVPRGIVAHNAHEAEQAAKELGTPVVVVKAQVHAGGRGKAGGV
KLAKSPEEAAKIAAEMIGSRLKTYQNPEGLSINCVLIEEGVNIDKEFYVGLTLDRETSRP
VFMVSAAGGMEIEEIAKTNPELIIKEHVDPAIGLLPYQARKIAFKIGLTDRKLVSQFVKI
LMTLSKMYFDLDASLIEINPLVKTKEDNFICLDAKIDFDDNALYRHPDIQELEDTTQIDP
LELEAKKWDLNYVRLDGNIGCMVNGAGLAMATMDTIKFFGGEPANFLDVGGTATVERVAA
AFKLLLSDPKVKAIFVNIFGGIVRCDRIAGGIIEAAKQVELDRPLIVRLEGTNVELGRKM
LEESGLNIIPAKDMADGAQKAVKAAKGEL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacacgagtatcaagccaaagaaatcttcaaaaagtacggccttcccgttccg
agaggcattgttgcccacaacgcccacgaagctgaacaggccgcaaaggaactgggaacg
ccggtagtagttgtaaaggcccaagtccacgcagggggaaggggtaaagccggcggcgtt
aagctcgcaaagtcccccgaagaggctgcaaaaattgcagcggaaatgataggaagccgg
ctgaaaacctatcaaaaccccgagggactgtcaatcaactgtgtcctcattgaggaaggg
gtaaacatagacaaggagttctacgtaggcctgaccctcgacagggagacctcaaggccg
gttttcatggtgtctgcagcggggggaatggagattgaagagattgcaaaaacgaacccc
gagctcatcatcaaggagcacgtagacccggcgatagggctgctgccctaccaggccagg
aaaatcgcctttaaaatcggtttaaccgacaggaagctcgtaagtcagttcgtaaaaatc
ctcatgaccctctccaaaatgtacttcgacctcgacgcctccctgattgaaatcaacccc
cttgtaaagaccaaagaggacaacttcatctgcctcgacgcaaaaatagacttcgacgac
aacgccctctaccgccaccccgatattcaggagcttgaagacaccacccagattgacccg
ctggagctcgaggccaaaaagtgggacctcaactacgtaaggctcgacggcaacatcggt
tgcatggttaacggtgccggccttgcaatggcaaccatggacacaatcaagttcttcggc
ggagagcccgcaaacttccttgacgttggcggaacggccacagttgaaagggttgcagcc
gcgttcaagctcctgctctccgaccccaaagtgaaggcaatcttcgtaaacatcttcggc
ggaatcgtcaggtgcgacaggattgcaggaggaatcatagaggccgcaaagcaagtagag
ctcgacagacccctaattgtgaggctcgagggaacaaacgttgagcttggaaggaagatg
ctcgaggagagcggcctcaacataattcccgccaaagacatggccgacggcgcccagaag
gcggtaaaagcagcaaaaggtgaactgtaa

DBGET integrated database retrieval system