KEGG   Thermovibrio ammonificans: Theam_1408Help
Entry
Theam_1408        CDS       T01391                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tam  Thermovibrio ammonificans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Theam_1408
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theam_1408
   00640 Propanoate metabolism
    Theam_1408
   00660 C5-Branched dibasic acid metabolism
    Theam_1408
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Theam_1408
Enzymes [BR:tam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Theam_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1373052..1374221
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQAKEIFKKYGLPVPRGIVAHNAHEAEQAAKELGTPVVVVKAQVHAGGRGKAGGV
KLAKSPEEAAKIAAEMIGSRLKTYQNPEGLSINCVLIEEGVNIDKEFYVGLTLDRETSRP
VFMVSAAGGMEIEEIAKTNPELIIKEHVDPAIGLLPYQARKIAFKIGLTDRKLVSQFVKI
LMTLSKMYFDLDASLIEINPLVKTKEDNFICLDAKIDFDDNALYRHPDIQELEDTTQIDP
LELEAKKWDLNYVRLDGNIGCMVNGAGLAMATMDTIKFFGGEPANFLDVGGTATVERVAA
AFKLLLSDPKVKAIFVNIFGGIVRCDRIAGGIIEAAKQVELDRPLIVRLEGTNVELGRKM
LEESGLNIIPAKDMADGAQKAVKAAKGEL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacacgagtatcaagccaaagaaatcttcaaaaagtacggccttcccgttccg
agaggcattgttgcccacaacgcccacgaagctgaacaggccgcaaaggaactgggaacg
ccggtagtagttgtaaaggcccaagtccacgcagggggaaggggtaaagccggcggcgtt
aagctcgcaaagtcccccgaagaggctgcaaaaattgcagcggaaatgataggaagccgg
ctgaaaacctatcaaaaccccgagggactgtcaatcaactgtgtcctcattgaggaaggg
gtaaacatagacaaggagttctacgtaggcctgaccctcgacagggagacctcaaggccg
gttttcatggtgtctgcagcggggggaatggagattgaagagattgcaaaaacgaacccc
gagctcatcatcaaggagcacgtagacccggcgatagggctgctgccctaccaggccagg
aaaatcgcctttaaaatcggtttaaccgacaggaagctcgtaagtcagttcgtaaaaatc
ctcatgaccctctccaaaatgtacttcgacctcgacgcctccctgattgaaatcaacccc
cttgtaaagaccaaagaggacaacttcatctgcctcgacgcaaaaatagacttcgacgac
aacgccctctaccgccaccccgatattcaggagcttgaagacaccacccagattgacccg
ctggagctcgaggccaaaaagtgggacctcaactacgtaaggctcgacggcaacatcggt
tgcatggttaacggtgccggccttgcaatggcaaccatggacacaatcaagttcttcggc
ggagagcccgcaaacttccttgacgttggcggaacggccacagttgaaagggttgcagcc
gcgttcaagctcctgctctccgaccccaaagtgaaggcaatcttcgtaaacatcttcggc
ggaatcgtcaggtgcgacaggattgcaggaggaatcatagaggccgcaaagcaagtagag
ctcgacagacccctaattgtgaggctcgagggaacaaacgttgagcttggaaggaagatg
ctcgaggagagcggcctcaacataattcccgccaaagacatggccgacggcgcccagaag
gcggtaaaagcagcaaaaggtgaactgtaa

DBGET integrated database retrieval system