KEGG   Thermovibrio ammonificans: Theam_1408Help
Entry
Theam_1408        CDS       T01391                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00020  Citrate cycle (TCA cycle)
tam00640  Propanoate metabolism
tam00660  C5-Branched dibasic acid metabolism
tam00720  Carbon fixation pathways in prokaryotes
tam01100  Metabolic pathways
tam01110  Biosynthesis of secondary metabolites
tam01120  Microbial metabolism in diverse environments
tam01130  Biosynthesis of antibiotics
tam01200  Carbon metabolism
Module
tam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tam_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Theam_1408
   00640 Propanoate metabolism
    Theam_1408
   00660 C5-Branched dibasic acid metabolism
    Theam_1408
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Theam_1408
Enzymes [BR:tam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Theam_1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A CPSase_L_D2 ATP-grasp ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: ADU97371
JGI: Theam_1408
UniProt: E8T442
Position
1373052..1374221
Genome map
AA seq 389 aa AA seqDB search
MKIHEYQAKEIFKKYGLPVPRGIVAHNAHEAEQAAKELGTPVVVVKAQVHAGGRGKAGGV
KLAKSPEEAAKIAAEMIGSRLKTYQNPEGLSINCVLIEEGVNIDKEFYVGLTLDRETSRP
VFMVSAAGGMEIEEIAKTNPELIIKEHVDPAIGLLPYQARKIAFKIGLTDRKLVSQFVKI
LMTLSKMYFDLDASLIEINPLVKTKEDNFICLDAKIDFDDNALYRHPDIQELEDTTQIDP
LELEAKKWDLNYVRLDGNIGCMVNGAGLAMATMDTIKFFGGEPANFLDVGGTATVERVAA
AFKLLLSDPKVKAIFVNIFGGIVRCDRIAGGIIEAAKQVELDRPLIVRLEGTNVELGRKM
LEESGLNIIPAKDMADGAQKAVKAAKGEL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaagatacacgagtatcaagccaaagaaatcttcaaaaagtacggccttcccgttccg
agaggcattgttgcccacaacgcccacgaagctgaacaggccgcaaaggaactgggaacg
ccggtagtagttgtaaaggcccaagtccacgcagggggaaggggtaaagccggcggcgtt
aagctcgcaaagtcccccgaagaggctgcaaaaattgcagcggaaatgataggaagccgg
ctgaaaacctatcaaaaccccgagggactgtcaatcaactgtgtcctcattgaggaaggg
gtaaacatagacaaggagttctacgtaggcctgaccctcgacagggagacctcaaggccg
gttttcatggtgtctgcagcggggggaatggagattgaagagattgcaaaaacgaacccc
gagctcatcatcaaggagcacgtagacccggcgatagggctgctgccctaccaggccagg
aaaatcgcctttaaaatcggtttaaccgacaggaagctcgtaagtcagttcgtaaaaatc
ctcatgaccctctccaaaatgtacttcgacctcgacgcctccctgattgaaatcaacccc
cttgtaaagaccaaagaggacaacttcatctgcctcgacgcaaaaatagacttcgacgac
aacgccctctaccgccaccccgatattcaggagcttgaagacaccacccagattgacccg
ctggagctcgaggccaaaaagtgggacctcaactacgtaaggctcgacggcaacatcggt
tgcatggttaacggtgccggccttgcaatggcaaccatggacacaatcaagttcttcggc
ggagagcccgcaaacttccttgacgttggcggaacggccacagttgaaagggttgcagcc
gcgttcaagctcctgctctccgaccccaaagtgaaggcaatcttcgtaaacatcttcggc
ggaatcgtcaggtgcgacaggattgcaggaggaatcatagaggccgcaaagcaagtagag
ctcgacagacccctaattgtgaggctcgagggaacaaacgttgagcttggaaggaagatg
ctcgaggagagcggcctcaacataattcccgccaaagacatggccgacggcgcccagaag
gcggtaaaagcagcaaaaggtgaactgtaa

DBGET integrated database retrieval system