KEGG   Thermovibrio ammonificans: Theam_1512Help
Entry
Theam_1512        CDS       T01391                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
tam  Thermovibrio ammonificans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Theam_1512
Enzymes [BR:tam01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Theam_1512
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1475443..1476015)
Genome map
AA seq 190 aa AA seqDB search
MVEAVSGTVSGKGDGAVFLSCGCFTLRLLVPERLLPELHEGTHVTLYTELLFPQEGAPQL
FGFKTREERELFRQLMKVPKVGSRLALAVLSVFSPEEFVKVLEGEDVEALSKVPGLGRKL
SRRLITELKGKLVSGEVPREVKEVLRRLGYTTAEINEALKGLNLTGVGVEEAVKEALKRL
SGSLGDRETE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggttgaggcggtcagcgggaccgtttccggcaagggagacggcgctgttttcctcagc
tgcggctgttttactttaaggctgcttgtccccgaaaggctccttcccgagcttcacgag
ggaacccatgtgaccctttacacagagctgctcttcccccaggagggggctcctcagctg
ttcggctttaaaacccgggaggagagggagctcttcaggcagcttatgaaggttcccaaa
gtgggaagccgccttgcccttgcggttctctccgttttctctccggaggagtttgtgaag
gtgctcgagggggaagatgttgaagccctctctaaggtgcccgggttggggcggaagctc
tcccgtaggctcatcacggagctgaagggaaagcttgtaagcggcgaggtgccccgggag
gttaaggaggttctgaggaggctcggctacacaacggccgagataaacgaagccctgaaa
ggcctaaatttaaccggtgtaggagttgaagaggccgttaaagaggcccttaaacgcctt
tcggggagtttaggtgatagagagaccgagtag

DBGET integrated database retrieval system