KEGG   Thermovibrio ammonificans: Theam_1626Help
Entry
Theam_1626        CDS       T01391                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tam  Thermovibrio ammonificans
Brite
Enzymes [BR:tam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Theam_1626
Secretion system [BR:tam02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Theam_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1582978..1583877)
Genome map
AA seq 299 aa AA seqDB search
MRTLIASVLSLLLISSCGMATENTKAQPQKSLTTEEKIIKALLNPLKVKGIEVEKIEPTE
AVKVPGFKTYEVTMIDKRRHREIKRYIFMTPDGKYLTLEIFKVRREGDVVHLTPLRPKNA
EKPLKVDLSWVKQVDKALTEHNVPHVVGKGDKKVYIVWDIFCPFCYEHFNQIEELAKKNG
VEIHLIPFPIHGENSIKGLVVYTQMARKEGAAGALKELYRMGNGSFMVYAKKMEERIKKE
EAKVPGREKLEEFFTQLREQLAKNGVRATPSIIYMPPNSGGKGYIYIGFKPIDQVINGK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagaaccctaatcgcctctgtgttgtcgctgctgctcatcagctcttgcggcatggca
accgaaaacacaaaggctcagccccagaagagcttaacaaccgaggagaagataataaag
gcccttctcaacccgctgaaggttaaaggaatagaggttgagaagatagagcccacagag
gccgtaaaggtgcccggctttaaaacctacgaagttacgatgatagacaagaggcgccac
agggagattaagcgctacatcttcatgacccccgacggcaagtacctgacgctggagata
ttcaaagtcaggcgggaaggggacgttgttcacctgacgcctttaaggccgaagaacgcc
gagaagcccctgaaggttgacctctcctgggttaagcaggtagataaagccctcaccgag
cacaacgttccccacgttgtgggcaagggggataagaaggtttacatagtttgggatatc
ttctgccccttctgctacgaacacttcaaccagatagaggagctggccaagaaaaacggc
gtagagattcacctgattcccttccccatccacggtgagaactcgataaaggggcttgtt
gtctacacccagatggcgaggaaagagggagctgccggggcccttaaggagctgtacaga
atgggcaacgggagctttatggtttacgcaaagaagatggaggagcgtataaagaaagaa
gaggctaaggttccagggagggagaagcttgaggagttcttcacccagctgagggagcag
cttgccaagaacggcgtaagggcaacgccctctatcatctacatgcctcccaacagcggc
ggtaaagggtacatctacatcggctttaagcccatagaccaggtgataaacggcaagtaa

DBGET integrated database retrieval system