KEGG   Thermovibrio ammonificans: Theam_1638Help
Entry
Theam_1638        CDS       T01391                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tam  Thermovibrio ammonificans
Pathway
tam00900  Terpenoid backbone biosynthesis
tam01100  Metabolic pathways
tam01110  Biosynthesis of secondary metabolites
tam01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tam00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Theam_1638
Enzymes [BR:tam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Theam_1638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ADU97594
JGI: Theam_1638
UniProt: E8T5E0
Position
complement(1596954..1597799)
Genome map
AA seq 281 aa AA seqDB search
MKLIVPAPAKVNLSLWINGKRPDGYHELVTVLHTVNLFDTLTFMPSDRFELQVEGDQLLP
LGRSNLIVKAAELFRRATGIKPNVKIKLLKKIPIGAGLGGGSSNAAAALKALNTLYGKPL
SEPELHQLAAQIGSDVPFFIRGGLAVATGRGEKLKHYNPAHFKLLLVYPDFSCPTAEVYK
SLPPINREMGVEDAEKLIISPLIVGNLREVAENAHNDLEESKHPCVERVKREVKPVLEEV
GVKPIMSGSGSCVFGLVEDEKEIDLSPLKKSGWWYKLLTAI
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttatagttcctgcaccggcaaaagttaacctttccctctggataaacggcaag
aggcccgacggctaccacgagctcgttaccgttctacacacggttaacctctttgacacc
cttacctttatgccctccgataggttcgaactccaggttgaaggcgaccagctgctcccc
ttgggaaggagcaacctcatagtaaaggctgcggagctctttaggagggctaccggcata
aagcccaacgttaagataaagctgctgaagaagattccgattggtgcgggccttggggga
ggctcctcgaacgctgctgcggccctgaaggctttaaacaccctttacgggaagcctctt
tcggagccggagcttcaccagcttgccgctcaaataggcagcgacgttcccttcttcatt
aggggcggcctggccgtggcaacgggcaggggggagaagctcaaacactacaatcccgcc
cactttaagcttttacttgtctatcccgactttagctgtcctacggcggaggtttacaag
agccttcctccgataaacagggaaatgggcgttgaagacgccgagaagctcataatctct
cctcttatagtagggaacctgagagaagttgccgaaaacgcccacaacgaccttgaggag
agtaagcacccttgcgttgaaagggtcaagagggaagttaagccggtccttgaagaggta
ggtgttaaaccgataatgagcggcagcggctcctgcgttttcggccttgtggaagatgaa
aaagaaatcgacctctcccccttgaaaaagagcggctggtggtataaattactcaccgcg
atatag

DBGET integrated database retrieval system