KEGG   Thermovibrio ammonificans: Theam_1809Help
Entry
Theam_1809        CDS       T01391                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tam  Thermovibrio ammonificans
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pTHEAM01:complement(61941..62717)
Genome map
AA seq 258 aa AA seqDB search
MKRFAVALTVLAVSLTAAPAGAEEVVLSGGVKGELHLVKEKTENVKVYSLTVKRGRVKET
FKVYRVGKLYFAEPTAMVKEGKFFLPYPAGRVKTEVKPFSPEELSDFRRAYSSFVAAAGL
REPDTGKPKLYVVFDPLCPYCERAVRSGEMKKLMASYDLRAVPFPVHGKLSERIAACLLK
KAEEERAPFEKVVAEWFKDSPREKRELLNSCGQNLSKEELILRKLSRELRSLEITGTPTF
IYSDGTISVGKPEAKDGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaggtttgctgtggctcttacggttcttgcagtttctcttacggcagctcccgcc
ggggcagaggaggtagtcctctccggcggagttaagggggagcttcaccttgtgaaggag
aagaccgaaaatgtgaaggtttacagcctgaccgttaagaggggaagagtaaaggagact
tttaaagtctatcgggtgggaaaactctactttgcggaaccgacggcgatggtgaaggag
ggaaagtttttcctgccctatcctgcgggcagggtaaagacggaggtaaaaccgttctct
ccggaggagctttccgacttcagacgggcctactcgtcctttgttgcggccgccggattg
cgggagcctgataccgggaaaccgaagctctacgttgtttttgaccccctatgtccgtac
tgcgagagggcggttaggagcggagagatgaagaagctcatggcctcttacgacctgagg
gcggttcctttccctgttcacgggaagctcagcgagaggatagccgcatgccttctgaag
aaggcagaggaggaaagagctccctttgagaaggtcgtcgcggagtggttcaaggactct
cctcgcgagaagcgggagcttctcaattcctgcgggcagaatctctcgaaggaagagctc
attctccggaaactctccagagaactccgctcccttgagattacgggcacaccgaccttt
atctactccgacggcacaatctctgtagggaaaccggaggcgaaagatgggcgttag

DBGET integrated database retrieval system