KEGG   Theileria annulata: TA02810Help
Entry
TA02810           CDS       T00253                                 

Definition
protein kinase
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     TA02810
Protein kinases [BR:tan01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   TA02810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 709 aa AA seqDB search
MEVSEHIDDHILSRYKIIQKIGKGAYGIVWKAVKRDTNEVVALKKIFDAFRNSTDAQRTY
REIMFLQKLKKCPNIVKLRDVYPADNNRDVYLVFEYVETDLHAVIRSNILEEVHKRYILY
QLLKAIHFIHTGDLLHRDLKPSNVLLNNKCNIKLADFGLARSVAPNNNSLDKCLSKDNHT
GTGIVMTDYVATRWYRAPEILVGSTKYTKGVDMWAIGCIFAEMLIGKPMFPGSSTINQLA
KVITFTGMPSEEDMESLSSPFTKVMISSLNTIRRKNIKEYFPNTSEECLDLLSKLLQFNP
TKRINTVEALSHPYLSNFHKNTPLPRLSRAISIPVCDNVKYDLINYRHLIYKFIQSNSNI
NNSLDNTINTVNNVNSGNTVGTVSMVSNSVNTGNTGNTVNLVDKSVDSIKNINYSITNVK
NMNNSNGIENNFSQCNLDVNSVQNNQNMNLDSGNSNLWIKNNSDINLNLSNTNNTSNMSN
VSNNVSNSVNTVNMVNNSTNNTNNSNSMNNMIEESMRYYSINSNEEYEMYEKGKLSVEYL
KAKNLGSILKPIQYQNIKPQFNTKGQFNNKFINTKLQFNNNKFINNNKFPNKLQFNNNNK
GQVNTNNKGQITNNKGQVTNNKYKGQNFPDKRFNTFQHFNTYNTNQFNTNTINHNIHNTF
TNNPINNMNNMNNGMIGMIGMNKEFGVGNIFPLCKFVPKKQERFDSINQ
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgagtgaacatatagatgatcatatattatctcgttataagataattcaaaaa
attggaaagggtgcgtatggtatagtttggaaggcagtgaaacgagatacgaatgaagtg
gtggcgttgaagaagatttttgacgcgtttaggaactcaacagatgctcagagaacttat
agagaaataatgttcttacaaaagcttaaaaaatgtccaaacattgtgaaattgagggat
gtgtaccctgcagataataacagagacgtttatctcgttttcgagtatgttgaaactgat
ttacacgccgtaatccgctcaaacattcttgaggaagtacataaacgttatattctttac
caattattaaaggctattcactttattcatactggtgacttacttcacagggatcttaaa
cccagtaatgtactattgaataacaagtgtaatattaaattggctgatttcggtcttgct
agatctgtagcaccaaataataattcacttgataaatgtttatcaaaagataatcatact
ggaacaggaattgtaatgacggattatgtagcaacacgttggtatagagcaccagagata
ttagtaggtagtacgaaatatactaaaggagtagatatgtgggcaataggttgtatattt
gcagaaatgttaattggtaaaccaatgtttccaggttcatcaacaataaaccaattagca
aaagtaattacatttacgggtatgccatcagaagaagatatggaatcattgtcaagtcca
ttcactaaagttatgatctcatcactcaatacaatacgtcgtaaaaatattaaggaatat
ttcccaaacacttctgaagaatgtttggatttattaagtaaattattacagtttaatcca
accaagagaattaatactgtagaagcactttctcatccatatttgagtaatttccataaa
aacacaccattaccaagattatccagagctattagtatacccgtctgtgataatgtcaaa
tatgatctcatcaattatcgtcatttaatatataaattcattcaatccaattccaatatt
aataattctctcgataatactattaataccgttaataatgtgaattctgggaatactgtt
ggtacggtgagtatggtgagtaattcggtgaatactggtaatactggtaatacagtgaat
ttggtggataaaagtgttgatagtattaagaatataaattattcaattactaatgttaag
aatatgaataatagtaatggtatagaaaataattttagtcaatgtaatttggatgtgaat
tcagttcaaaataatcaaaatatgaatttagatagtggaaatagtaatttatggataaaa
aataattcagatataaacttaaatttatccaacacgaacaatacgagtaatatgagtaat
gtgagtaataatgtgagtaattcggtgaatacggtgaatatggtgaataattccaccaat
aataccaataattccaatagtatgaataatatgatagaagagagtatgagatattatagt
ataaatagtaatgaagaatatgaaatgtatgaaaagggtaaattatcagtagaatattta
aaggcaaagaatcttggaagtatacttaaaccaatacaatatcaaaatataaaaccacaa
tttaatactaaaggacaattcaataataaatttattaatacgaaactgcaatttaataat
aataaatttatcaataataataaatttccaaataaattacaattcaataacaataataaa
gggcaagtcaatactaataataaaggacaaattactaataacaagggacaagttacgaat
aataaatataaaggacaaaattttcctgataaaagatttaatacttttcaacatttcaat
acatataatacaaatcaattcaataccaatactataaatcataatatacacaatacattt
actaataatccaataaataatatgaataatatgaataatggaatgattggtatgattggt
atgaataaagaatttggagttgggaatatatttccattatgtaaatttgtaccaaagaaa
caagaaagatttgattctataaatcaatag

DBGET integrated database retrieval system