KEGG   Theileria annulata: TA04090Help
Entry
TA04090           CDS       T00253                                 

Definition
cytochrome reductase (EC:1.6.2.4)
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     TA04090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3
AA seq 647 aa AA seqDB search
MIEDLSVIINLGLGISCIITQLYILKYKNKITKKLDFDKKCKIFYASQTGTSERFSRILY
DKLLQFNICSNKPIDLEDFKEEEFYIEDSIFIFLISTHYDGLFPDNTKNFLKILKKLEIN
NTNLKINYCIFGLGNSDYEYFNQAAKLLQSSLNSLNANEFIPIYLSDELNGINKEFDNWF
KILIKSFNKIYNKNFIITNQEPNYYKSWRHLCELEMRYENIIMKNNFVPIPKDIICKQQY
QCIEAKIIQNYNLIPNSDQSVHEIIWIKLLHLFQDMVILIKKLLFHHHFLYQILLRYPVT
VLAHTATRILPERGSLLLFSSLSLSYGAWFYGTSTSTTTVKLYCDLTSLPNDEIILNFCT
FIKDKKEIERIEQIINSKLMKLIREEVKLLFNEFLILFFPNVKFNLSGFLQLIPKQIPKA
YTISSIPNKNIKIIVKKVEYNLHSLKTFYKINMNKNIFNEVTKTELYKRRIYKGNCSNYL
CNLIVGDTIKFFIRSSIFSNINFNNNFLLIANGTGTPLRCLQQQLQSPIYTITSSLVIYL
VIYKENLFLLTRSILNIYFQNPIFWNYFFNFLVIWVNFGLISILGISGIRPIYKLIEEKK
LNNKVIIYLGFRSKNHILYHEELNHLQNLNNFHISYAFSREQVNSSK
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagatttgagtgtaataataaatttgggacttggaatctcatgtataattaca
caattatatatattaaaatataaaaataaaattacaaaaaaattggattttgataaaaaa
tgtaaaatattttatgctagtcaaactggaacttctgaacgtttttctagaatactttat
gataaattattacaatttaatatatgttctaataaaccaattgatttagaggattttaaa
gaggaagaattttatattgaggattcgatatttatatttcttatatcaacacattatgat
ggattatttccagataatactaaaaactttcttaaaattttgaaaaaattagaaataaat
aatacaaatttaaaaattaattattgtatttttggtcttggtaatagtgattatgaatat
ttcaatcaagctgctaaattattacaatcttcacttaattcacttaatgcaaatgaattc
attccaatatatttaagtgatgaattaaatggaattaataaagaatttgataattggttt
aaaatattaataaaatcatttaataaaatttataataaaaattttattattactaatcaa
gaaccaaattattataaatcttggagacatttatgtgaattagaaatgagatatgagaat
ataataatgaaaaataattttgtaccaataccaaaagatataatatgtaaacaacaatat
caatgtatagaagctaaaataatacaaaattataatttaataccaaattctgatcaatct
gtacatgaaattatttggataaaattattacatttgttccaagatatggtaatattaatc
aaaaaactactttttcaccaccatttcctataccaaatactattaaggtatcccgttacg
gtgcttgctcacacggccacccgtatcctccctgaaaggggctccctactattatttagc
tccctttccctcagttacggtgcttggttctacggtactagtaccagtactactactgtt
aaattatattgtgatttaacaagtttaccaaatgatgaaataatattaaatttttgtaca
tttataaaagataaaaaagaaatagaaagaatagaacaaataataaattcaaaattaatg
aaattaatacgtgaagaagttaaacttttattcaatgaatttttaatattattctttcca
aatgttaaatttaatctttctggattcttacaacttatacctaaacaaatacctaaagca
tatacaatctcatcaataccaaataaaaatataaaaataatagtaaaaaaagtggaatat
aatttacattcattgaaaacattttataaaataaatatgaataaaaatatatttaatgaa
gtaacaaaaacagaattatataaacgtagaatatataaaggaaattgtagtaattattta
tgtaatttaattgttggtgatactattaaattctttataagatcttctatattttctaat
attaattttaataataattttctacttattgctaatggaacaggtactccgttacggtgc
ttgcaacagcagctccaatcacctatttataccattactagttctttagttatataccta
gttatctataaggaaaatttatttctcctaacccgatcaattttgaacatttatttccaa
aatcctattttttggaattattttttcaattttttagttatttgggttaattttggatta
attagtatattaggaatatctggtataagacctatatataaattaattgaagaaaagaaa
ttaaataataaagtaataatatatttgggttttagaagtaaaaatcatattttatatcat
gaagaacttaatcatttacaaaatcttaataattttcatatttcatatgctttctcaaga
gaacaagtaaatagcagcaaataa

DBGET integrated database retrieval system