KEGG   Theileria annulata: TA04775Help
Entry
TA04775           CDS       T00253                                 

Definition
clathrin heavy chain
Orthology
K04646  
clathrin heavy chain
Organism
tan  Theileria annulata
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:tan00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    TA04775
Exosome [BR:tan04147]
 Exosomal proteins
  Proteins found in most exosomes
   TA04775
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3
AA seq 2068 aa AA seqDB search
MNNYPIITNTILNLRNLGFVDNNFKFDVLSLEDRYISIKEQDGDNLTVAIIDLYNNNSII
RKPMKAEAAIMNPNKPIIALRAKLDNNYSIQVYLIYTNFSYYQFDQRIIYWKWLNNMELV
IITETLVYHWMIGSNPKYMFELTGKLLDSNTKIVGYSSDITNKWCLVFGIYSNDQGVSID
GVIQLYSVDKRQQQLFEGYAGTFTQLRTNNQTLKKSNLLIFCEHKKNTHNIKLHLMDIGS
LGQSNTSNGVSSGVGTSVGTTGTTTGGTDILKINCIMERNEEFPNDFPISIHVFDSNGII
LILTKNGFAHFYFSNTLTHLFTVRISMYSLFVSCNKKENNKSIGALTVNRIGEVINIIID
ENNLLSYLTHLSTQSLEFSVLSGQSGQSGQSVGTMEMRFKEVCNDIATCYGIKGSDEILI
ELFEKYFNNEQYKQAAQIVATLKSNKLRTYDIIQRFKNKSTETGNALSYYFSILLEVDKL
NEIESIELIKPVILQNRKELIKKWLENNKLTESETLGDLIYEIDYTIAFKIYNKLHLYQK
AINCLLYPITSVTVTGTPNSITTTGPTSTTSTTTTHTTTTTHTTTTTHTTTTNEKQIDII
INYIYKIINMVGMDGITIFTNELNEKIIIINQLKFDFIINQLDNNLLIKFINNLLIPINI
SRDGVSITANNSTKRSSTTGPERGHLNTNSTTTGNTTSNNTISSIDDIIDTNTNDNIKGT
SFGGVVGASTVTGTVTVENVLLCNIIEIMEKLIEMKKLKEMNEILLDYLKEDLEIHEKLQ
TRLLQVNIENDKRIGEEILKLDILTKFNKNYIAKLCEDNELYEYSLKYYNDITNIKRILI
KGIYFLSQNIINQTLLTFNIQDSLYFLQQLHNEYIGISGGVGDVSREFEGEFGGEFEEKF
DEKNRKVEEKVDRLENIIINICLILYNKINLKELTNILTNKLFYKFFKKLSKQELDEDIN
EIIIRYMKLCIEYNDIIELENILLYNNNFNLFDAKELIKNSQLSTTKPFIIICYRLNNIQ
ELLLFLFNYYDTVLAQPDTNSTNNLTTSTIGTVVPGIKDTTTVGASTVTGTVKEELILKD
IKILLEMNPKLLTEVIIILLELSEELINKILINITNITLLKEIIKLIEERHQLIILKPFL
EMKCKEINEPILHTALMKIYITLGENPEDYLINNKYYLKEEIANYCQDIDLQLSLLIYKH
NSMYEHFIKFSLKHQLYKSLYQFLLKESNIKFYQYYYSNCNDMKEIIKLCIENCNSIEIS
VLIKFLLSENLNEDLIILLEGLLLNQTEFTNNSNLQNLLLATTIKTYSNQLDDLNQLDYY
SRSDSNKLDSNKLDDSIRLDSTKLDDSTKFSDSTKLNDPNQLDGPGKLEYYLNKLNNYDV
NSLAKLANDLKLHYSAFLIYNKSNKYNEAFNQLILLHSKSTEGTKVEVKGARSEEVKEVT
KSESTKDSEDTVGPSTVTEKILKLMYKYSEEINNEMIWFKLGKIYLENNKLKESINCYLK
SKNFTHHHEIKLKLMNNQMNNQINNQNNNENDELLLFWLLETNKIKPTSELIIDLLIHLA
KLRFLQHFNFLINSSVTVTGTTGTGTEVTGTVVPGSSTTIGASTVTEGKGANSTAMECPT
PTPTTKNTIGIIGTDPVTDLSNISIDNMKIDLNIVGNELIKLGLYMEAIQVFIKMNNYNK
LAICYIEINKYNEACEAALMSKNPKILKQTFDYLIQHFGNVDNKLLNRVGIELLNYPEFL
VSVVASYESMGLFDDLIELLRNTTKTVATSTELAICIAKYHPEELMEHLRNVAFESNSLN
ISKTARECSNLWLWREAVFLYTIDDSDKAILSMILHPECFEEQLFFRTLANVSNTEVIYK
ALYFYIQQYPTAVNKLLSCVKFKLDTGRVIKILRNNNCLQLAKEYFQQSDRNSQQINDTL
YEIYVEEHDFESLEQDVSKYINYDYMKLCTLLEEHPLARMREIGAKILSRHNHYSRASII
YMKNNNYIKAIDCARLSKSTQLVHETINNLILKEELNYLLVALVINFHLLDLPMVLESVW
LNNVNLDVIMPLIIHLQRFINYKKPNSH
NT seq 6207 nt NT seq  +upstreamnt  +downstreamnt
atgaataattatccaattattactaatacaattctcaatttgagaaatttgggatttgtt
gataataattttaaatttgatgtattatcacttgaagatcgttatataagtataaaagaa
caagatggtgataatttgacagttgcaattattgatttgtataataataattccattatt
agaaaaccaatgaaagctgaagctgctattatgaatcctaataaaccaattattgctcta
agagctaaacttgataataattattctattcaagtatatttaatctatacaaattttagt
tattatcaatttgatcaacgtataatatattggaaatggttgaataatatggaattagta
ataataacagaaacattagtatatcattggatgataggttcaaatccaaaatatatgttt
gaattaacagggaaattattagattctaatacgaaaattgttggttactcgagtgatatt
acaaataaatggtgtctagtgtttggtatatattctaatgatcaaggtgtcagtattgat
ggtgtaatacaattatattctgtagataaacgtcaacaacaattatttgaaggttatgct
ggtacttttacacaattacgtacgaataatcagacacttaagaaatccaatctattaatc
ttttgtgaacataaaaaaaatacacataatatcaaattacatcttatggatattggttcc
ctaggacaatctaatactagtaacggagttagtagtggtgtaggtaccagtgtaggtact
actggtactactactggtggtacggatatattgaaaataaattgtataatggaaagaaat
gaagaatttcctaatgattttccaatatcaatacatgtttttgattcaaatggaattata
ttaattctaacaaaaaatggttttgcacatttttatttttctaatactctaacacatctt
ttcacagtaagaataagtatgtattcattatttgtaagttgtaataagaaagaaaataat
aaaagtattggtgcattaacagttaatcgaattggtgaagttattaatattattatcgat
gaaaataatttattatcatatctaacacatttatctacacaatcattagaattttcagta
ctatcaggacagtctggtcagtcaggacagtcagttggtacaatggaaatgagatttaaa
gaagtatgtaatgatatagcaacatgttatggtataaaaggatcagatgaaatattaatt
gaattatttgagaaatattttaataatgaacaatataaacaagctgcacaaattgttgct
acacttaaatctaataaattaaggacatatgatattatacaaagatttaaaaataaatct
actgaaacaggaaatgcgttaagttattattttagtatattattagaagtggataaattg
aatgaaatagaaagtatagaattaataaaaccagtaatactacagaatcgtaaagaatta
ataaaaaaatggttggaaaataataaattaactgaatcagaaacattaggtgatttaata
tatgaaattgattatactatagcatttaaaatttataataaattacatttatatcaaaaa
gctattaattgtttattatatccaattacttccgttacggtgactggtacaccaaacagt
attactaccactggtccaacgtccaccacctctactactactactcatactactactact
actcatactactactactactcacactactactactaatgaaaaacaaatagatataata
ataaattatatatataaaataattaatatggttggtatggatggtataacaatatttaca
aatgaattaaatgagaaaattattattattaatcaattgaaatttgattttattattaat
caacttgataataatttattaattaaatttattaataatttgttaattccaattaatatt
tcacgtgacggtgtcagtatcacggcaaacaatagtaccaagagaagtagtaccaccggc
cccgaaaggggccaccttaatactaactctactactactggtaatactactagtaataat
actattagtagtattgatgatattatagatactaatactaatgataatattaaaggaacc
tcttttgggggtgtcgttggagcaagcaccgtaacgggcaccgtaacggtcgaaaatgtt
ctattatgtaatataatagaaataatggaaaaattaatagaaatgaaaaaattaaaagaa
atgaatgaaatattattggattatttaaaagaagatttagaaatacatgagaaattacaa
acaagattattacaagtaaatatagaaaatgataaaagaattggtgaagaaatattaaaa
ttagatattttaacaaaatttaataaaaattatatagcaaaattatgtgaagataatgaa
ttatatgaatattctttaaaatattataatgatattactaatattaaacgtatattaatt
aaaggtatttatttcttatcacaaaatattattaatcaaactttattaacatttaatata
caagattctttatattttttacaacaattacataatgaatacattggtataagtggagga
gttggggatgtaagtagagaatttgagggagaatttggaggagaatttgaagagaaattt
gatgagaaaaatagaaaagttgaagaaaaagttgatagattagagaatataataataaat
atttgtttaatattatataataaaataaatttaaaagaattaacaaatatattaactaat
aaattattttataaattttttaaaaaattatctaaacaagaattggatgaagatataaat
gagataataatacgttatatgaaattatgtatagaatataatgatataatagaattagaa
aatatattattatataataataattttaatttatttgatgctaaagaattaattaaaaat
tcacaactttctactactaaaccttttattattatttgttatcgtttaaataatatacaa
gaattattattatttttatttaattattatgatacggtgcttgctcaaccagatactaat
agtactaataacctaactactagtactataggtacagttgtacctggtattaaggatact
actacagttggagcaagcaccgtaacgggcaccgtaaaggaagaattaatattaaaagat
ataaaaatattattagaaatgaatccaaaattattaactgaagtaataataatattatta
gaattatcagaagaattaataaataaaattttaatcaatataaccaatataacattatta
aaagagataataaaattaatagaagaacgacatcaattgataatattgaaaccattttta
gaaatgaaatgtaaagaaataaatgaaccaatattacatacagcattgatgaaaatatat
ataacacttggtgaaaatccagaagattatttaattaataataaatattatttaaaagaa
gaaattgctaattattgtcaagacattgatttacaattatcattactcatttataaacat
aattctatgtatgaacattttattaaattctctttaaaacatcaactttataaatcttta
tatcaatttctattaaaagaatctaatattaaattttatcaatattattattctaactgt
aatgatatgaaagaaataataaaattatgtattgagaattgtaatagtattgaaataagt
gtattaataaagtttttattatcggaaaatttaaatgaagatttaatcatattattagaa
ggtttattattaaatcaaactgaattcactaataatagtaatttacaaaatcttttatta
gctactactattaaaacttattctaaccaactagacgatcttaatcaactagattattac
agtagatcggattctaataaactggattctaataaacttgatgattccattagactagat
tccactaaactggatgattctactaaattcagtgactccacaaaactcaatgatcctaac
caattggatggtcctggtaaattggaatattatttgaataaacttaataattatgatgta
aattcattagctaaacttgctaatgatttaaaattacattattcagcatttcttatttat
aataaatctaataaatataatgaagcttttaatcaattaatattattacattctaaaagt
acagaggggactaaggttgaggttaagggagctaggagtgaggaggttaaggaagttact
aagagtgaaagtactaaggatagtgaagatacagtaggaccaagcaccgtaacggaaaaa
atattaaaattaatgtataaatatagtgaagaaataaataatgaaatgatctggttcaaa
ttaggtaaaatatatttagaaaataataaattaaaagaaagtatcaattgttatttaaaa
agtaaaaattttacacatcatcatgaaattaaactcaaactaatgaataaccaaatgaat
aaccaaattaataaccaaaataataatgagaatgatgaattattattattttggttattg
gagacgaataaaattaaaccaacatctgaacttattattgatcttttaatccatttagct
aaattacgttttttacaacatttcaattttttaattaattcctccgttacggtgactggt
accacgggtacaggtacagaggttactggtacagttgtacctggttccagtactaccatt
ggagcaagcaccgttactgagggaaagggagctaattctacagctatggagtgtcctact
cccactcccactactaagaatactattggtataattggaactgatcctgtaacggattta
agtaatatttcaattgataatatgaaaatagatttaaatattgtaggaaatgaattaata
aaattgggattatatatggaagcaatacaagtatttataaagatgaataattataataaa
ttagcaatttgttatatagaaattaataaatataatgaagcatgtgaagctgcactcatg
tccaaaaatcctaaaatactcaaacaaacatttgattatttaattcaacattttggaaat
gtggataataaattattgaatagagttggtatagaattattgaattatccagagtttcta
gtgagtgtagtagcaagttatgagagtatgggactatttgatgatttgatcgagttgtta
agaaatacgacaaaaacagtagcgacatcaactgagttggcgatttgtatagccaaatat
catccagaagagttaatggagcatctaaggaacgttgcatttgagtcaaattcattgaat
atatccaagacggcaagagaatgtagtaatttatggctatggcgagaggcggtgtttcta
tacaccatcgacgactcagataaggcgattttgtccatgatactacatccagaatgtttt
gaagagcaactgttcttccgtacactagccaacgtaagtaatactgaagtgatttacaag
gcattatatttctatatccagcagtatccaacagctgttaacaagttattatcatgtgtc
aagtttaaacttgatacaggacgtgtgattaagattctaaggaataataattgtctacaa
ttggccaaggaatatttccaacagtctgaccgtaactcacaacaaatcaatgatacatta
tatgaaatatacgttgaagaacatgactttgaatcattagaacaagatgtgagcaagtat
ataaactatgattatatgaaattgtgtacattattggaagaacatccactagcaagaatg
cgtgaaattggagctaaaatattatctagacataatcattattcaagagcatcaataata
tatatgaagaataataattatatcaaggctatagattgtgcaagattatctaaatctaca
caactagtccatgaaactataaataatttaatattaaaggaggaattaaattatttatta
gtagcattggttattaattttcatttattagacttgccaatggtattagaatctgtttgg
ttaaataatgttaatttagatgtcattatgccattaataatacatttacaacgatttatt
aattataaaaaaccaaattcacattaa

DBGET integrated database retrieval system