KEGG   Theileria annulata: TA04955Help
Entry
TA04955           CDS       T00253                                 

Definition
cGMP-dependent protein kinase
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     TA04955
Protein kinases [BR:tan01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   TA04955
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3
AA seq 890 aa AA seqDB search
MSSKIDELTASFKNLANTFANRSMSKDKNPTIRKQRSKFIKKSNEAESYEDTEIVKHLVK
RQKSESDKSFIKKSLANNVIFSTLNDLEMSAFVDSMSYYVFSVGSKVTEQGTNGSYFFVI
NDGIFDVYIDGKLVNTMERGTAFGEISLINDTPRTATVMVRGVTENVKASSDTLGSLWGV
NRTVFRETLKNISMEVYSQNRSFLDSVKIFEMLTENQKNMVTNAFVESKFVPGDRIVTQG
DFGDVLYIIKEGKADVLINDEKVRTLTNGQYFGERALLYDEPRSATIVATEDTVCVSLGR
EILNKVLGNLDNVLFRNVMMEYLQNSTVFRQFTPDQLAKLIESASVRDFKLGDVILHKEE
KIKGIRFFILLEGSVQILYEDNEIGVMERGDSFGEEYVLSPEIPFAHTVKCISNDKRAEG
NCKLALLTKHAIHEILGTDLIDEKLDYNNKLSVIKKMYIFRYLSEAHLDMLIKKFKSKRY
KKGEYIIREGEVGDSFYIISKGDVDIIKSGTRLRTLGKNDYFGERALLYDEPRTASVVCS
SANSDLWVVEKSVFLKIVEDPMLSHLENRIRVQDTKVLFEDLRTVKQIGRGTFGTVNLVV
HEPSQLRFALKCVSKKLIVYNKQQKNIKMEKEIMAQNDHPFIIQLVKTFKDDENIYFLTE
LVTGGELFDALRKLELLKKPQAQFYLGSIILALEYLHERQIIYRDLKPENVMLDHQGYIK
LIDFGSAKKIEGRTFTVIGTPQYMAPEVIMGKGYNCMADIWSIGICLYEFICGPLPFGDD
AVDQFDVFKKVLHGKFPDFMKDQDAINLIKRLLCRKTELRIGNSINGFKDIKEHPYFRDF
DWDLLACRGLKPPLIPDEENYNQEFDDEQPKISEQDLDSDVSSDDWEQDF
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagtaaaatagatgaattaacggctagcttcaaaaatctagccaacacattcgca
aataggtccatgagcaaagacaaaaatcctaccatcagaaaacaaagatctaaatttata
aaaaaatcaaatgaagctgaatcatacgaagatacagaaattgtaaaacatctagtaaag
cgccaaaagagcgaatctgacaaatcctttataaaaaagtcactggcaaacaatgtgatc
ttctctacacttaatgatctggaaatgtcagcctttgtggactcaatgtcctattatgtc
ttctcagttggctcaaaagttacagaacaaggcacaaatggctcttacttctttgttata
aatgatggcatcttcgatgtgtacattgacgggaaacttgtcaacaccatggaaagagga
acggctttcggagaaatatccctgataaacgacacaccacgaacagcaacagttatggtg
agaggagtaacggaaaatgttaaggcctcaagtgatactctgggatcactttggggagta
aaccgaacggtattcagggaaacactaaagaacatttccatggaagtctattcccaaaat
aggtcatttttggactcagttaagattttcgaaatgctaactgagaaccagaaaaacatg
gtaaccaacgcatttgtggaatccaaatttgtaccaggagataggattgtaacacaaggt
gattttggtgatgttctgtacatcataaaggagggaaaagcagacgtattaataaatgac
gaaaaggtaagaacactcacaaacgggcaatatttcggagaaagagccttgctttacgat
gaaccgaggagtgcaacgatagtagccactgaagatacggtctgtgtttcattaggccgt
gaaattttaaataaagtcttgggcaacctagataacgtgttgttcagaaacgtaatgatg
gaataccttcagaattcgacagtattcagacagttcacacctgatcaactggcaaaactt
attgaatccgcaagcgttagagactttaagctcggcgacgtaattttacataaggaagag
aagatcaaggggataaggttcttcatactcctcgaaggctcagttcaaattttatatgag
gataacgagattggagtcatggaaagaggagactcgttcggagaagaatacgttttgtcg
ccagaaataccattcgcccacacagtcaagtgtatcagcaacgacaaaagagcagaagga
aactgcaaattagcactcctaaccaaacatgcaattcatgagattttaggaactgactta
attgacgagaaacttgattataacaacaaattgtctgtaataaagaagatgtatatcttc
agatacctgtcggaggcccatcttgatatgctgataaaaaaattcaagagcaaaagatat
aagaagggagaatacataataagagaaggagaagttggagatagtttttacatcataagt
aaaggagatgtagacatcataaagtctggaacacgcctaagaacactggggaaaaatgac
tactttggagaaagagcattgttgtacgatgagcccagaactgcatcagtggtgtgttcc
tcagcaaactcggacctttgggtcgttgaaaagtctgtattcctcaagattgtagaggac
ccgatgttgtcacatttagagaacagaatccgtgttcaagacactaaagtcttatttgaa
gacctgcgcactgttaaacagataggaagaggtacctttgggaccgtcaacctggtagtt
cacgaaccaagccaactcagatttgcactcaaatgcgtgagtaaaaagctcattgtatat
aacaaacaacaaaaaaatattaaaatggaaaaagaaattatggctcaaaatgaccaccca
tttattattcaactagtaaaaacgtttaaagatgatgaaaatatatatttccttactgag
cttgtaactggtggagaactatttgacgcactaagaaaacttgaattgttaaaaaaacca
caagcacagttttacctaggatcaatcatactggctctagaatatttacatgaacgccaa
attatatacagagatttgaagccggagaatgtgatgttggaccaccaagggtacattaaa
ctgattgactttggttctgctaaaaaaatagagggaagaaccttcacggtgattgggacg
ccacagtacatggcgccggaagtcataatgggcaagggatataactgtatggctgacatt
tggagtattggaatttgcctgtacgagtttatatgcgggccgcttccattcggagatgat
gctgtggaccagtttgatgtgttcaagaaagtgttacatggcaagtttccagatttcatg
aaagatcaagatgcaatcaacctgatcaagagactactttgtagaaaaactgaacttaga
ataggaaactctataaacggattcaaagatatcaaagaacacccatactttagagatttt
gattgggatttattggcttgcagaggtttgaagccgccattgattccagatgaagaaaat
tataaccaagagtttgacgacgaacaacctaagatctcggaacaagatttagattccgat
gtaagctcagacgactgggagcaagatttttaa

DBGET integrated database retrieval system