KEGG   Theileria annulata: TA05510Help
Entry
TA05510           CDS       T00253                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
tan  Theileria annulata
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tan00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
3
AA seq 382 aa AA seqDB search
MIKAHVAICTLILTNIYTTLLTAAAQTFTKSHYEQKYNTKLEKLKPDEVIHEPLKKFAHG
SCQRTYPQLKDIYNTILKYDPDIFFFTGDNFYTEMNCCDERCIERGYLKMINFPPFQEFK
KKIKKFDGVYDDHDYGINDGDATFKFKEFAQQTILDFFEKPKDHYRRKRKGVYFSLSYID
PENPNNHVKIIALDLRYHRGCMYNCICQLCGLTYIQSRLIMLRRFFNYTFGIGCKHDADV
LGEEQWKWFESQLVDSEARSHVIVSSFQVFTHHPMGESWGHFPVSKKRLLDLVEATRPRK
PVFISGDVHFAELFEKYVPQGLVEFTSSSLTHSVMTHNYLATVLAYPVYLRLKEYIYRNN
NFGALEFNYNQQNGNSSYKKLF
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgattaaagctcatgtggccatttgtaccctaattttaacaaacatctacacaacactg
ctcacagcagcggcacaaacattcacgaaatcacactatgaacaaaaatataacactaag
ctggaaaaattaaagccagatgaagtgatacacgagcctctaaaaaaattcgctcacggc
agctgtcaaagaacatatccacagctcaaggatatatacaataccatactcaaatacgat
cctgacatcttcttctttacgggagataatttttacacagaaatgaactgttgcgacgag
aggtgtattgaaagaggctacttaaagatgataaactttccgcccttccaagaatttaaa
aagaaaatcaagaaattcgacggcgtttacgacgatcatgattatggaataaatgatgga
gatgcaacttttaaatttaaagaattcgctcagcagacaatattagattttttcgaaaag
ccgaaagatcattataggaggaagaggaaaggagtgtactttagcttgtcgtatattgac
cctgaaaacccaaataaccatgttaaaattattgcattagaccttaggtaccacagaggc
tgtatgtataattgtatttgccaactatgtgggctaacatacatacaatcgaggttaatt
atgttacgaagatttttcaattatacctttgggattggttgtaaacatgacgctgacgtg
ctgggagaagagcagtggaagtggtttgaatcgcaacttgtagactctgaagccaggtcc
catgtaatagtatcatcattccaagtatttacccaccacccaatgggtgaaagttgggga
cattttccagtctctaaaaagagattactggacttggttgaagccacaagaccacgaaag
ccggttttcatatccggagatgttcatttcgccgaactcttcgagaaatatgtaccacaa
ggacttgttgagttcacatctagcagtttgacgcatagtgttatgacacacaattattta
gctacggttttggcctaccccgtttatctccgattaaaggaatacatttacagaaacaac
aacttcggggctcttgagttcaattataaccaacaaaatggtaactcaagttataaaaaa
ctattttaa

DBGET integrated database retrieval system