KEGG   Theileria annulata: TA06075Help
Entry
TA06075           CDS       T00253                                 

Definition
protein disulfide isomerase (thioredoxin)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
tan  Theileria annulata
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TA06075
Enzymes [BR:tan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TA06075
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 347 aa AA seqDB search
MSRLFLRLLFCVVLFKFAYTTSYYKDSKVLEVKEDDFDNKVKSFKVTLVKFYNESCKKCV
EFSEVYKNLANIFHDLVQVLAVNDESLSKKYKVKSFPSLKLFLGNGKESEPDVVDLDEDK
DLDDLVSFTLKTLKKHVKQRASKFLPKDSKKVVQLTSSNFDSLVLDDTYSQWYFYSILMF
IIIRLVKFYAPWCGHCKNLEPEWMSLPKKSKGVKVGRVDCTVHQSLCSQFNVMVFYYSLF
SLSYINYYGYPTILLFNKGEKSPKTAMNYEGHRTSADILAFAKKNDKALSPPTHATSVSD
LKEKCSGPLCLLFFFNTSTKEENLKTLKSFASKHSAPFALAYSMGLL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggttatttttgaggttattgttttgtgttgttctctttaaatttgcctatact
actagttactacaaggattccaaggttttggaagtcaaagaagatgattttgataacaaa
gtcaaaagttttaaagttacactagtcaaattttacaacgaatcgtgtaagaaatgtgta
gagttttcagaagtgtataagaatttggccaacatctttcacgatttggttcaagtttta
gctgttaatgacgagtctttgtctaagaaatacaaagtcaagtcattcccttcacttaaa
ctttttctcggaaatggcaaggagtctgaacctgacgtggtggaccttgatgaagataag
gacttggatgacttggtatcttttaccttaaaaacacttaaaaaacatgttaagcaaaga
gcttcaaaattccttcctaaagattctaagaaggttgtccaactaacttcttccaacttt
gactcattagttcttgatgacacatatagccaatggtatttttattcaattttaatgttt
ataattattaggctggttaaattttacgctccttggtgtggacactgtaaaaaccttgag
cctgaatggatgagtttacctaaaaagagcaaaggggttaaagtcggaagagttgactgt
actgttcatcaatctctttgctctcaattcaacgttatggttttttattattcattattc
tcacttagttatataaattactatggatatcctacaatattattattcaacaagggtgaa
aagagtcccaagactgctatgaattatgaaggccatagaacttctgctgatattttggca
ttcgccaagaagaacgataaggctctctcccctccaactcatgccacttcagtctcagac
ttgaaggaaaagtgcagtggtccactttgtctcctattcttttttaatacctcaacaaaa
gaagaaaatctcaagactcttaagtcattcgcttccaaacattctgcaccatttgctctc
gcatactccatgggtttgttataa

DBGET integrated database retrieval system