KEGG   Theileria annulata: TA06415Help
Entry
TA06415           CDS       T00253                                 

Definition
DEAD-box family (RNA) helicase (EC:3.6.1.3)
Orthology
K01509  
adenosinetriphosphatase [EC:3.6.1.3]
Organism
tan  Theileria annulata
Pathway
Purine metabolism
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TA06415
Enzymes [BR:tan01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.3  adenosinetriphosphatase
     TA06415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 455 aa AA seqDB search
MLFYIITVIYGSISVYSYIISDSRIKYGNIPNYTRLESDEIIQNLNPTILSNLEKIGIQS
LNQLQYECIPKILDDYIKNVCILSQTGTGKTLSYLVPIVQMILNSEEESTCVVIVPNSIL
MYQVYDVLNNLTSGLNIKVKTVDDVEKGKVPNIVISSPLKLLNKFKTYSLNYNFDAFKTV
KYLVLDEVDQLFVHKQIIIEILKRTKNRCKTILSSSTLPDYGTKSDSNTVSKLFKNCSYI
KSQDLHKIPSKVSLEFINYKDEDDRGMLILYRFNKVVEYLYSNNDRMIIYCNSSVNCEKL
YNKLSNLGKNVHILNKNIDLMEQLLILTSLDKKMIILSTDHSSRGVDFKNIKTVIHYDFP
TNVVNFIHRTGRVGRHGNEGNCLAFWSESDEFLKNHIENNLNSFVDCFIIFFRLSKVFSR
KRGLRKKFKKAQKLLEPTLSQEISSESQEYSTESV
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgttattttatattatcactgtaatatatggatcaattagtgtatattcatatattata
tcagattccagaataaagtatggaaatattcctaattacacacgattagagtcagatgag
attatccagaatttaaatcctacgattttgtcaaatctcgaaaaaataggaatccagagt
ctaaaccaattgcaatacgaatgtattccaaagattcttgacgattacataaagaatgtg
tgtattttatcgcaaactggcaccgggaaaacactatcatacttggtcccaattgtacaa
atgattcttaattcggaagaagaatcaacttgtgtagttatagtcccaaatagtattttg
atgtatcaagtttatgatgttttgaataacttaacaagcggacttaatattaaagtcaag
actgtagacgatgttgaaaagggaaaagtaccaaacatagtcatatcatctccattaaaa
ttactcaacaaattcaaaacgtattccttaaactataattttgatgcttttaaaactgtt
aaatacctggtcctggatgaagttgaccagttatttgttcataaacagattataattgag
attctcaaaaggactaagaataggtgtaagacaattttatcgtctagtacattgccagat
tatggaacgaaaagtgattctaacactgtatctaaattgtttaagaactgttcatatata
aagtcgcaagacttacataagattccttccaaagtttcacttgaattcattaattacaaa
gatgaagatgatagaggaatgttaattttatataggtttaataaagttgttgaatatctg
tattcaaataatgatcgcatgataatttactgtaacagttcagtaaattgtgagaaattg
tataacaaattgtcaaatctcgggaaaaatgtacacatcctgaacaagaacattgatctt
atggaacagcttttgatcctgactagtttagacaagaagatgattatattgtcaactgac
cacagtagtcgaggtgttgactttaagaatattaagactgttatacattacgatttccca
accaacgtcgttaattttatacacagaactggtcgagttgggagacatgggaatgaaggc
aattgtcttgccttttggtcagagtctgatgagtttttgaaaaatcacattgaaaataat
ttaaattcgtttgttgattgttttattatattttttagactttcgaaggtttttagtagg
aaaagaggtcttcgaaagaagtttaaaaaggctcaaaagttactagaacctaccctgtct
caagaaatttccagtgagtctcaagaatattctactgaatctgtttaa

DBGET integrated database retrieval system