KEGG   Theileria annulata: TA06835Help
Entry
TA06835           CDS       T00253                                 

Definition
histone acetyltransferase
Orthology
K00653  
histone acetyltransferase [EC:2.3.1.48]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TA06835
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 452 aa AA seqDB search
MVTKQVQYKEDPADKNKQPTLNKSNSESQSLAIQKAREKSVILSKAREIFSQQFPTAYPM
EYELWGKDLMHNTWRRCTVVHARPVDPNKEIPLLKPNEYDYYIHWLGLDRRLDCWLTIEN
IRTMEQGPPKGAQVIHDIEPEFHHDHTGIDDEYLREHEINTKLKTIRRIKLGPFLVDTWY
FSPYPPPYQNIDTLYICEFCLSFFRYEEELNFHIVHCELRHPPGNEIYRDENLAMFEVDG
AMSTVYCENLCFLSKLFLDHKSLRHTVFLFIFYVMTEFDENGYHITGYFSKEKHSKNNVS
CILSLPQVLDYGLITLQHQRKGYGKYLTAFSYLLSKKEGKTGTPERPLSDLGKASYMSYW
SEVLLEILFDPKHENLTIQELSQMTAFEPNDIISCLEELGILHTLSNGNSVITILPEKKR
ELLSKSRTKTRKLYMEKLHWIPYDAHNELTPV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgaagcaggtccaatacaaggaggaccctgcagataaaaacaagcagcccacc
ttgaacaaatctaatagtgaatcccaaagcttagcaatacaaaaagcccgagaaaaaagt
gttatactctcaaaagcaagagaaatcttctcacagcagttcccaactgcatatcccatg
gaatatgagctctgggggaaagatttgatgcataatacgtggagaagatgtacagtagtc
catgcaaggccagtggacccaaacaaagaaatcccgctcttgaaaccaaatgagtacgac
tactatatacactggttgggtctagatcgcagactagactgctggctgacgatagaaaac
ataagaaccatggaacagggacctccgaaaggagcacaagtaatccatgatattgaacct
gaattccaccacgaccatacaggaattgacgatgaatacctgagggaacatgaaattaat
actaagctaaaaactattagaagaattaaactaggtcctttccttgtcgacacttggtac
ttttctccatacccccctccatatcaaaatatcgacacactctacatctgcgaattctgt
ctctcgttctttagatacgaggaggagctaaacttccatatcgttcattgtgaattaaga
catcccccaggaaatgaaatctacagggatgaaaatctcgcaatgtttgaagtcgacggg
gctatgagcacagtatattgtgaaaatttgtgttttctgtcaaagttattcctggaccat
aagagcctaaggcacacagtctttttgtttattttctacgtcatgacagagtttgatgaa
aacggataccatatcacgggctatttttcaaaggagaaacactccaaaaataacgtttcc
tgtatactatcgctaccacaggtacttgattatggactaataacccttcagcaccagaga
aagggatatggaaagtatctaactgcattcagctacctcctttcaaaaaaggaagggaaa
actggaacacccgaaagacccttatcagacctcggaaaggcttcttacatgtcatattgg
tctgaagttttgttggaaatactatttgaccctaaacatgaaaatttgacaatacaggaa
ttatctcaaatgactgcttttgagccgaatgatatcatttcttgcctggaagagcttgga
attctacacacactctcgaatggaaactcagttataactatactcccagaaaagaagaga
gagttgctctcgaaatcgagaaccaaaactaggaaattatacatggaaaaactccattgg
ataccatacgacgcacataacgaactaacacctgtgtaa

DBGET integrated database retrieval system