KEGG   Theileria annulata: TA06835Help
Entry
TA06835           CDS       T00253                                 

Definition
(RefSeq) histone acetyltransferase, putative
Organism
tan  Theileria annulata
SSDB OrthologParalogGFIT
Motif
Pfam: MOZ_SAS Tudor-knot Orthopox_A43R
Motif
Other DBs
NCBI-GeneID: 3863758
NCBI-ProteinID: XP_954028
GeneDB: TA06835
UniProt: Q4UHT8
Position
1
AA seq 452 aa AA seqDB search
MVTKQVQYKEDPADKNKQPTLNKSNSESQSLAIQKAREKSVILSKAREIFSQQFPTAYPM
EYELWGKDLMHNTWRRCTVVHARPVDPNKEIPLLKPNEYDYYIHWLGLDRRLDCWLTIEN
IRTMEQGPPKGAQVIHDIEPEFHHDHTGIDDEYLREHEINTKLKTIRRIKLGPFLVDTWY
FSPYPPPYQNIDTLYICEFCLSFFRYEEELNFHIVHCELRHPPGNEIYRDENLAMFEVDG
AMSTVYCENLCFLSKLFLDHKSLRHTVFLFIFYVMTEFDENGYHITGYFSKEKHSKNNVS
CILSLPQVLDYGLITLQHQRKGYGKYLTAFSYLLSKKEGKTGTPERPLSDLGKASYMSYW
SEVLLEILFDPKHENLTIQELSQMTAFEPNDIISCLEELGILHTLSNGNSVITILPEKKR
ELLSKSRTKTRKLYMEKLHWIPYDAHNELTPV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgaagcaggtccaatacaaggaggaccctgcagataaaaacaagcagcccacc
ttgaacaaatctaatagtgaatcccaaagcttagcaatacaaaaagcccgagaaaaaagt
gttatactctcaaaagcaagagaaatcttctcacagcagttcccaactgcatatcccatg
gaatatgagctctgggggaaagatttgatgcataatacgtggagaagatgtacagtagtc
catgcaaggccagtggacccaaacaaagaaatcccgctcttgaaaccaaatgagtacgac
tactatatacactggttgggtctagatcgcagactagactgctggctgacgatagaaaac
ataagaaccatggaacagggacctccgaaaggagcacaagtaatccatgatattgaacct
gaattccaccacgaccatacaggaattgacgatgaatacctgagggaacatgaaattaat
actaagctaaaaactattagaagaattaaactaggtcctttccttgtcgacacttggtac
ttttctccatacccccctccatatcaaaatatcgacacactctacatctgcgaattctgt
ctctcgttctttagatacgaggaggagctaaacttccatatcgttcattgtgaattaaga
catcccccaggaaatgaaatctacagggatgaaaatctcgcaatgtttgaagtcgacggg
gctatgagcacagtatattgtgaaaatttgtgttttctgtcaaagttattcctggaccat
aagagcctaaggcacacagtctttttgtttattttctacgtcatgacagagtttgatgaa
aacggataccatatcacgggctatttttcaaaggagaaacactccaaaaataacgtttcc
tgtatactatcgctaccacaggtacttgattatggactaataacccttcagcaccagaga
aagggatatggaaagtatctaactgcattcagctacctcctttcaaaaaaggaagggaaa
actggaacacccgaaagacccttatcagacctcggaaaggcttcttacatgtcatattgg
tctgaagttttgttggaaatactatttgaccctaaacatgaaaatttgacaatacaggaa
ttatctcaaatgactgcttttgagccgaatgatatcatttcttgcctggaagagcttgga
attctacacacactctcgaatggaaactcagttataactatactcccagaaaagaagaga
gagttgctctcgaaatcgagaaccaaaactaggaaattatacatggaaaaactccattgg
ataccatacgacgcacataacgaactaacacctgtgtaa

DBGET integrated database retrieval system