KEGG   Theileria annulata: TA06965Help
Entry
TA06965           CDS       T00253                                 

Definition
1-phosphatidylinositol-4,5-bisphosphatephosphod ie sterase (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tan  Theileria annulata
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TA06965
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    TA06965
Enzymes [BR:tan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     TA06965
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1
AA seq 974 aa AA seqDB search
MSKQINNQWISNLSAGCSNDSPAISEFLSEHLKRISLCDSLNLIFKGGYLRKWRRSSRLT
LSDPKNGTKNLALPYINATPIYSSQSHGRSHELFFWVSKVCDTLFLRWQSRRKRSSESIF
PLCAIKSIHRGDELTYFDHRDPFDGVSLKFIFVINGKVSLQLGAQSETDALLWISGLYFA
ARYARNEFSVHWITNSELFNSFLQSCKKNAKPGDCDFDTKALKRCLNDKYVGLLYMSNYD
KIKAEDDDWLLPHNLAQFVEYLVTFGFVSRPENADVITSMVRRLLEFRNNINAGFVQMTS
MIDSSAKPAHIIRVCIEHFDSLNVQYKVLKKDIQAIYPELTDQECEDMFYNIVRQCALRV
ILRTTTEKSDFIQQISPADYESFLRNIQSSDSNEVVANVIQIQSWLSPLSYIPDTPPEVR
SGGCFRKVNVPRIPVRFLTVLGFNWSLTSYFNSICIPQDSDEICSVLSLKLTDFWVSSSH
NTYLVGDQLGGSASASSIAEALLRGCRCIELDCQDGSEEPVLCHAWKNCHLTGSVTLREG
LIAIKEAAFENNKLPVILSFEMNCSDDFKFKTFELVTQILGDELLTLDDDDPIDIVVRCE
LGSLLNKFIIKAKHKSSDSTFLGPGETAWQSLITLRGLDIDKLEDNKIDSIKRNSVFAIS
ETKFLKMSKDQSLITALSERCFVRVYPSATRLASTNFCPLKPWSYGVQFAALNFQSYDRS
MLINHGRFYNSFGYVPKFIYKNYSDDFVEPTESNTNIKNSDKINNDIMLTLHVLSGSQLP
TSTGFQNQNYSSSFSNVLYSIGEQNMFLNKSNLNLQTFAKFKEKRKLKQAIKEGLELDEE
ESGDTTLFNVINKSAKTVLEYKQKVCPFVEVSVVGVDETTFTTKPVNFNTFNPVWSDSNP
PFIFKIENPNQAIVLFYVKHYDNISSEIIGQAAFPVNRLRPGIRWVQLLDSKFMEIECSG
LLVYVEMEPLHKDQ
NT seq 2925 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaaatcaataatcaatggatttccaacttatcagcgggatgctcaaatgat
agtccagctataagcgaattcttatcggaacatttaaagcgaatttctttatgcgattcg
ctaaatttaatatttaaaggcggatatctacggaaatggcgtagatcatcccgtttaact
ctatcagacccaaaaaacgggacaaaaaaccttgctttaccatatataaatgcaactccc
atttacagttcacagtctcacggaagatcgcacgagctgttcttctgggtttcaaaggtg
tgcgacactcttttccttcgatggcagtcgcgaagaaaacgtagtagcgagagtatcttc
ccgctctgtgccataaaaagcatccatagaggagatgaactgacctactttgaccatcgt
gacccgtttgacggcgtgagccttaagttcatatttgttattaacgggaaggtttcacta
caattgggggcacagtcagaaactgatgctcttctctggatctcaggactgtatttcgcg
gccagatacgcacgcaatgagttttcagtgcactggattacaaactcagaacttttcaat
tcatttcttcaatcatgcaagaaaaatgcaaaacccggcgactgtgactttgacactaaa
gctttgaagcgttgtctaaacgataaatacgtagggcttttgtacatgagcaactatgac
aaaatcaaggccgaagatgatgactggcttctacctcacaatttggctcaatttgtcgaa
tatttggtgacttttggatttgtttctaggcctgagaatgccgacgtaatcacatcaatg
gtacgacgtctgcttgagttcagaaataacattaatgccggattcgtccagatgacttca
atgattgacagtagcgctaagccagctcacatcatacgcgtttgtattgagcattttgat
tcattaaatgtacaatacaaagtactgaaaaaagacatacaggccatttaccctgaactc
acagatcaagaatgcgaggacatgttctacaatatagtacggcaatgcgctctcagagta
atactgagaacgaccactgagaaatccgactttattcagcagattagtccagcagattac
gagtcgtttctgcggaacattcagtcatcagattctaacgaggtggttgcaaacgtaatt
caaatacaatcttggttatcccctttatcgtacatacccgatacaccgcccgaggtaagg
tcaggtggctgtttcaggaaagttaatgttcccagaattccagtaagattcctaacagtt
ttaggttttaactggtcactcaccagttattttaacagcatttgtataccccaagacagt
gacgagatttgctcagtattgagtttgaaattgacggatttctgggtatccagtagccat
aacacatacctggttggagatcaattaggaggttcagccagcgccagttctattgccgag
gctcttctccgcggatgcagatgcatagaacttgattgtcaggacggatccgaagagcct
gtgctctgtcacgcttggaagaactgtcacttgacaggatctgtgacgctccgtgaggga
cttatcgctataaaagaggctgcttttgagaataacaaattacctgtaattttatccttc
gaaatgaactgctcagatgatttcaaattcaagacctttgaacttgttacccagatattg
ggcgatgagctgttaactttggacgacgatgaccctattgacatcgttgtccgttgtgag
ctgggcagcttgttaaacaagtttataataaaggcaaaacataaatcatctgatagtacc
tttttaggtcctggagaaactgcctggcaatctttaataaccctaagaggcttggatata
gataaactcgaagataataaaatcgactcaattaagcgtaacagtgtgtttgctatttcc
gagactaaattccttaaaatgtccaaggatcaatctttgattactgctctatctgaacgt
tgttttgttcgtgtttacccttcagcaacaaggcttgcaagtaccaatttctgtccttta
aagccttggtcctatggtgttcaatttgcagccttaaactttcaatcttacgacaggtca
atgctgattaatcatgggcgtttctacaattcatttggctatgtaccaaaatttatctac
aagaactattcagatgattttgttgagcccacagaatctaatacaaatatcaaaaatagt
gataagattaataatgacataatgttaactttacatgttttgagtggttctcagttacca
acttcaactggatttcagaaccaaaattactctagttcgttcagcaacgtgttatattca
attggtgagcagaatatgtttctgaataaatctaacttgaatcttcaaacttttgcaaaa
tttaaggagaagcgaaaacttaagcaggcaattaaagaaggtctggagttagatgaggaa
gaatctggtgatactactctgtttaatgtgattaataaatctgctaaaactgttttagag
tacaagcagaaggtttgtccatttgtggaagtttctgttgttggtgttgatgaaaccacc
ttcactacgaaacctgtaaactttaacacttttaatcctgtctggtctgattctaatcca
ccttttatttttaaaatcgagaatcctaatcaggctattgttcttttttacgtcaaacac
tatgacaatatttcctctgaaattataggtcaggctgcttttccagttaacaggttgagg
cctggcatacgttgggttcagttattggactctaagtttatggaaatagaatgttcaggt
ttattagtatacgttgagatggagccattacacaaagatcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system