KEGG   Theileria annulata: TA07290Help
Entry
TA07290           CDS       T00253                                 

Definition
histone H2B (variant 1)
Orthology
K11252  
histone H2B
Organism
tan  Theileria annulata
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 123 aa AA seqDB search
MSGKVPSSKSHAAKKTAGKTLGVRYRRKKRVESFSLYIYKVLKQVHPETGVSKKSMSIMN
SFINDVFDRLALEATRLIRYNKKSTLSSREVQTAVRLLLPGELSKHAVSEGTKAVTKYTT
SGV
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaaaagtaccatcatcaaaatctcatgccgctaagaaaactgctggaaaaact
cttggagtaagataccgtaggaagaagcgtgttgagtcattttcactttacatatacaag
gtcttgaaacaggtgcaccctgaaactggtgtgagtaagaagagcatgagcatcatgaac
tcctttatcaatgatgtattcgaccgtcttgcacttgaagctactagactcattaggtat
aataagaaaagcacacttagctctcgtgaagtacaaactgctgtaagacttcttctacca
ggtgaactttcaaaacatgccgtatcagaaggaactaaagccgttactaaatacactaca
tctggagtctaa

DBGET integrated database retrieval system