KEGG   Theileria annulata: TA07540Help
Entry
TA07540           CDS       T00253                                 

Definition
eukaryotic translation initiation factor
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tan  Theileria annulata
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tan00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TA07540
Translation factors [BR:tan03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TA07540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 741 aa AA seqDB search
MVRVNPSDLSQEELEIGILDWVSDDDEEFDQSQLERFYEQDPPVTLDKSFKRTLMGIFYF
LNLFSVLGLPVVGPEKHDRLRDVVRKTITKELEKKGCEIQTPFVLEIPTDGSKQTKGLAF
FTFGTPFEANMALKFINKFKLDSSHAFKAILVDNFDMIVSDDNKCVPPLKTFGFTREGIR
DWWIMGERMRDQFVIRYADKTEVYWFDSVHREPKLAYDGSRERAEGRRPWADQKVEWSPN
GSYLAVYKWAGIALYGGNNFELKIRFEHKNVKNIQFSPCEEYLLTWDGSKGEDRHEKSIC
IWRVITGELLRSFPTPLKSPKGGDFPHLLWNRTGKYIAMLNQFLEGSEVLVYRLPEMTLI
EGPDGKPAPLKYSAEKFDWSPQDDILSVVIPGSLDTPARLVLVEIPSRRELSSRNVYNVC
EVAMHWHSKGDCLCLRTTISKKTGKKGRKQFNQLEIFRLRERNIPVDTIQIQDATVKQLH
WEEGGSKRFALIVKDEETRSHSIRFYKVSDVGATRDTVWTTTFDITSQLNHMQWSPAGNY
FVLGGLGAEGSLFFCALNDNDKVDVLYKDEHFMMNTIRWSSCGRYLATCVNVPMPQHNAT
TSDSFRYSAEAGYCLWTFQGRLLCKDRKENFYSFDFRPHPTPLLKRTEIEKIKKNLKEYT
KRYDLIDEKERKDYRDSYLQKRQNNLDAFKQLYSSLLQWYTSQDNYLEFKSGWDKFLNPL
DWEVTDEVYQEVIDIKEEVFE
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atggttagagtaaacccgtcagatctcagccaagaggaacttgaaataggcattttggac
tgggtttctgacgatgacgaagaatttgatcaatcacaactagaaaggttttacgaacaa
gacccacctgtaacgctggataaaagcttcaagagaacgttgatgggtattttttatttt
ttaaatttattttcagttttgggactcccagtggttggccctgaaaaacacgacagactt
cgagacgtagttcgtaaaacaataacaaaagagttggagaaaaagggatgtgagattcaa
acgccgtttgtactggagataccaacagatggtagtaagcagacgaaagggttggccttt
tttacatttggaactccatttgaagcgaacatggccctgaagttcataaacaagtttaag
ctggactcttcccatgcatttaaggccattttggtggacaactttgacatgatagtgagc
gacgataataagtgcgtgccaccactaaagacatttggatttacgagggaaggaattagg
gactggtggatcatgggagaacgcatgagggaccagtttgtaataagatacgcagacaaa
actgaggtgtactggttcgactcagttcaccgggagccaaagctggcatatgatggatcg
agagagagagccgagggtagaagaccatgggcagatcagaaagtagaatggagtccaaac
gggtcctatttagcagtttacaagtgggcaggaatagcactttacggaggaaataacttt
gaactgaaaataagattcgaacacaagaatgtaaaaaacatacaattctcaccatgtgaa
gaatatcttctaacatgggatggttcaaagggagaggacaggcatgaaaaatctatttgt
atctggagagttattacaggtgagcttttgaggagtttcccaacgccgttaaagtcaccg
aagggtggagacttccctcacctgctctggaacagaactggaaagtacattgcaatgctg
aaccagtttttagaaggcagtgaagtgctcgtttacaggctgcctgaaatgacactaatt
gaaggaccagacgggaaaccagcgcctctcaagtactcggctgaaaagttcgattggtct
cctcaagatgatatcctctctgttgttattccaggctcactagatactccagcgaggttg
gtgttggttgagataccgtcaagacgagagttgagttcaaggaatgtatacaatgtgtgc
gaagttgcaatgcactggcactcgaaaggagattgcctatgcttgaggactacgatttct
aaaaagactgggaaaaagggaagaaaacagtttaaccagcttgaaatattccgtctaaga
gaaagaaacataccagttgatacaatacaaatacaagatgcaacagtaaaacaattacac
tgggaagaaggtggaagtaagagatttgcgttgattgttaaggacgaggagactaggagc
cattccatcagattctacaaggtctcagatgtaggagccacgagagatactgtttggacg
acaacattcgacatcacctcacaactgaaccatatgcaatggtcaccagcaggaaactac
tttgtgctgggaggattgggcgcagaaggctcactctttttctgcgcactaaacgataac
gataaagtcgacgtgttatataaggatgagcactttatgatgaatacaataaggtggagt
agttgtggaaggtatttggcaacatgtgtcaatgtcccaatgcctcaacataacgcaaca
acctcagattcattcagatatagtgcggaagctggatattgcctgtggacattccagggc
agactgttgtgtaaggacaggaaggagaacttctacagcttcgatttcagaccccaccca
actccattgcttaaaaggacagaaattgaaaagatcaagaagaaccttaaggagtacacg
aaaaggtacgacctcatagacgaaaaggagaggaaggactacagagattcgtacctacag
aaaagacaaaataatctcgacgccttcaaacagctatattcatcactcttacagtggtac
acgtcacaggacaactatttggagttcaagtccggatgggacaagtttttaaacccgctg
gactgggaagtcacagatgaagtgtatcaggaagtaattgacataaaggaggaggttttt
gagtaa

DBGET integrated database retrieval system