KEGG   Theileria annulata: TA08265Help
Entry
TA08265           CDS       T00253                                 

Definition
(RefSeq) histone H2B, putative
  KO
K11252  histone H2B
Organism
tan  Theileria annulata
Brite
Chromosome and associated proteins [BR:tan03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    TA08265
Exosome [BR:tan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   TA08265
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa RP-C
Motif
Other DBs
NCBI-GeneID: 3863027
NCBI-ProteinID: XP_953070
GeneDB: TA08265
UniProt: Q4U9Q8
Position
4
AA seq 107 aa AA seqDB search
MVKKRVHKGKKKARSETYSTYIFKVLKQVHPDTGVSKKSMLVLNSFVTDTFEKLATEAGK
LCKYNKKETLSSREVQTAVRLVLPGELAKHAVSEGTKAVTKFTGKHH
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atggtaaagaagcgtgtgcataagggaaagaagaaggcccgttctgagacctacagcact
tatatatttaaggtgctgaaacaggtacacccagatacaggcgtttccaagaagtcgatg
ctagtgcttaactcgtttgtgactgacaccttcgagaagctcgccactgaggcaggcaag
ctctgcaagtataacaagaaggaaacactcagctctcgtgaggttcaaaccgctgtaagg
cttgttctccccggtgaactcgccaaacacgccgtctcagagggcactaaagccgtcacc
aaattcacaggcaaacaccattaa

DBGET integrated database retrieval system