KEGG   Theileria annulata: TA08590Help
Entry
TA08590           CDS       T00253                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tan  Theileria annulata
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:tan01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:tan01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tan00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:tan00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:tan00562]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 329 aa AA seqDB search
MEGNESISSLSMSKLVIGVNHLHNTSMRSNHIFIHWLNYLINQSYPYENWIIYGSSNNGV
LTLQRKLLRCLIKRFIIFYLKYIKRKWLGGNWKCNGTKQSISDLLLHFNRHQTKNNNLDV
VLFPPSLYVEHTRNELKSEVFELGVQNVSQSKSGAFTGELSLTMFTDFGLKWSLVGHSER
RQLFNEDDSYVCEKVMMLQENGVNAVVCFGETLSEREQGQTENVLKRQLDAFVKHVKDWD
KVVLAYEPVWAIGTGKVATVDQVKEAHKFVRDYVRGLVGDVADKVRLVYGGSVNEKNCLE
LSKCSDVDGFLVGGASLKKEFLDILKSLE
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaaatgagtctatctctagcctcagtatgagtaagctggtaattggtgtgaac
catttacataacacatctatgagatctaaccatatttttattcattggttaaattatttg
ataaatcaaagttatccatatgaaaattggataatttatggatcttcaaataatggtgta
cttacactccaacggaagttgttgagatgtttaataaaaagattcattatattttacttg
aaatatataaaaagaaagtggttaggcgggaattggaaatgcaatggaactaagcaatcc
atatccgatcttttattacattttaatagacatcaaacgaaaaacaacaatttagatgtc
gtactatttccaccttctctttatgtcgaacatactagaaatgaattgaagagtgaagtt
tttgaacttggcgtccagaatgtttctcagtctaaatctggagccttcactggagaattg
agcttaactatgtttacagatttcggcctaaaatggtcacttgttggtcactctgagcgt
agacagctctttaacgaggacgactcttacgtgtgtgaaaaagttatgatgttacaagaa
aacggtgtaaatgcagtagtttgctttggcgaaacattgtctgaacgcgaacaaggccag
acagagaatgtccttaagagacaacttgatgcctttgtaaaacatgtaaaggactgggac
aaagtagtattagcctatgaacctgtttgggcaatcggcactggtaaagttgcaactgtt
gaccaggttaaagaggcacacaagtttgtgagggattatgtgaggggattagttggagat
gttgccgacaaggtccgactagtttatggagggtcggtgaacgagaaaaattgccttgaa
ctttcaaagtgcagtgatgttgacggatttctagttgggggtgcttcgctcaagaaggaa
tttttggatattctgaaatcactagaataa

DBGET integrated database retrieval system