KEGG   Theileria annulata: TA08795Help
Entry
TA08795           CDS       T00253                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
tan  Theileria annulata
Brite
Enzymes [BR:tan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TA08795
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 577 aa AA seqDB search
MEKFTVMFHPCENIDNYLKNTYSFSPYYTHHFFNNDLNTSAIQWVRYDVYYIVDTYELFI
KVSGQLYMSKEDSDIRKSLYTVYNSIYSKIPEYTLILDEPTFKHLLYIRSVGTQKFIPPG
RIIAEIPLDNSLIFQLRYCVFQEESNTPNNLTNVSANQKSYYKRLSSEDSYIPEMTDKSI
YFKNTLDKDYFDSDLYDECYINISHKGNFDNCLIYDIIKFINKSSSDKHKNTRKSTYDRL
DFSVQENFNILHRRLEWFYHWFIEGASNIKPDSRWSVFIPLIILTYDSYDHEYKTTTNTI
SNLLTSNEEFEKCILNRSNDLNSQSIRLKIVQQPIGTISDMVHFKNKRTHLSKKLKQTAS
QYNVSIIGMVTAYYFFTLNHDRLRISQFMIFPNYWGKGFGLWVLEFIYRMAIMDSNVREI
TVEDPTSAFLILRYVVALKICFESKLIDPKILYGNNKSGFGILKLFSKESTIPSKDKISS
VCKESKACSSKLVEILQLASILPYPISSQKIVNQYTNKRQKINDIDVKLSLFIQSDTYMD
YCDKLKNKIKFEEIKGNGNTKNIKKLSPDKYLNSVCL
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggagaagttcactgtgatgtttcacccatgtgaaaacatcgacaattacttgaaaaac
acatactcattctctccatactacactcatcatttttttaataatgatttaaatacctct
gcaatccaatgggttagatacgatgtgtactatattgtcgacacatacgagttgtttata
aaggtatcgggacagttgtatatgtcaaaggaagattctgatatcaggaagtcactgtat
actgtatataactcgatttattcaaaaattccagaatatacattgatattagatgaaccg
acatttaagcatttgttatatatccgttctgttggaactcagaaattcatccctccaggg
cgtattattgccgagattcctctagataattcacttatttttcaactaagatattgtgtg
tttcaagaagaatctaacacaccaaataatttgactaatgtatcagcgaatcaaaaaagt
tattataagcgtctatcaagcgaagattcttatattccagaaatgacagataagtcaata
tattttaaaaataccctggataaagattatttcgacagcgatttgtacgacgaatgttat
attaatatctcacacaaagggaattttgacaactgtttgatctatgatataattaaattc
attaataagtcaagctcagataaacataaaaatactagaaaatcaacctatgatcgttta
gacttttcagtccaagaaaattttaacatacttcatcgaagattagagtggttttatcat
tggtttatagaaggtgcttctaatattaaacccgattccaggtggtcggttttcattcct
ttaataatattaacatacgactcttatgatcatgagtacaagactacaactaacactata
tcaaatttactaacatctaacgaggagttcgagaaatgcattttaaatagatcaaatgat
ttaaattctcaaagtattaggttaaaaatagtccaacagcccatagggacgatatcggat
atggtacattttaaaaacaagaggacgcatttatcaaaaaaattaaagcagacagctagt
caatataatgtatcaataattggaatggttacagcatattatttttttacattgaaccat
gacagactcagaatatcacagtttatgatattccctaattactgggggaaaggattcggt
ttgtgggtattggagtttatatacaggatggcgataatggattcaaatgtgagagaaata
actgtagaggatcctacatcagcatttctaattttgagatatgtagttgcactcaagata
tgttttgagtcgaaactaattgaccccaaaatattgtatggaaacaacaaaagtggtttt
ggaatattaaaattattttccaaagaatcaacgattccatccaaagataaaatatcttca
gtttgtaaggaaagtaaggcttgttcatctaagcttgttgagattctacaactagcttca
attcttccttatccaatctctagtcaaaaaatagtcaatcaatatactaacaaaaggcag
aaaataaacgatatagacgttaagcttagtctctttattcagtcagatacatacatggat
tactgtgataaattgaaaaataaaataaaattcgaagaaataaaggggaatgggaacaca
aagaatataaaaaagctctcgccagataaatatttaaattcagtatgtctataa

DBGET integrated database retrieval system