KEGG   Theileria annulata: TA10380Help
Entry
TA10380           CDS       T00253                                 

Definition
cyctochrome C
Orthology
K08738  
cytochrome c
Organism
tan  Theileria annulata
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    TA10380
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
4
AA seq 155 aa AA seqDB search
MSTSDDWNDIPDDFVLPEGSAERGAKLFKKHCKQCHSMRPDNRQTGGFSSIGPTLFNVYG
RTSGIQNLGGLNLMTHSMKSSGIVWDDANLMRFDFKAIKTFRYMKNPQLFVNSKIGMNFV
GLPRFQDRVDVVHFLRQLNYEGKYGKEVLKECEKK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacatcagatgactggaatgatattccggatgatttcgtactcccggaaggctca
gcagaaagaggagcaaagctctttaaaaaacattgcaagcaatgtcattccatgagacca
gataatcgccaaacaggaggatttagctcaattggtccaactttatttaatgtttatggc
cgcacttcaggaatccagaacctaggaggactcaacttgatgacccattcaatgaagtca
tctggaatagtgtgggatgacgcaaacttgatgaggtttgattttaaggcaattaaaaca
tttaggtacatgaaaaacccacaactgttcgtaaatagcaaaattggaatgaattttgtc
ggacttccaaggttccaggaccgcgtggatgttgtacacttccttcgccagcttaactac
gaaggaaagtatggaaaagaagtgctaaaagaatgcgagaagaaatga

DBGET integrated database retrieval system